Project name: pro aggregation

Chain sequence(s)	A: LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:37)

• Minimal score value: -3.9626
• Maximal score value: 1.6515
• Average score: -1.0626
• Total score value: -172.1337

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	L	A	1.6515
2	I	A	0.7350
3	V	A	0.0000
4	T	A	0.2498
5	Q	A	-0.4295
6	T	A	-0.5694
7	M	A	-1.1554
8	K	A	-2.0281
9	G	A	-1.3612
10	L	A	0.0000
11	D	A	-1.8014
12	I	A	-1.6293
13	Q	A	-2.3297
14	K	A	-2.7158
15	V	A	0.0000
16	A	A	-1.3447
17	G	A	-0.9166
18	T	A	-0.5419
19	W	A	0.0000
20	Y	A	-0.5940
21	S	A	0.0000
22	L	A	0.0000
23	A	A	0.0000
24	M	A	0.0000
25	A	A	0.0000
26	A	A	0.0000
27	S	A	0.0000
28	D	A	-0.7477
29	I	A	0.4788
30	S	A	-0.1672
31	L	A	-0.3845
32	L	A	0.0000
33	D	A	-1.7496
34	A	A	-1.2994
35	Q	A	-1.3273
36	S	A	-1.6890
37	A	A	0.0000
38	P	A	-0.6886
39	L	A	-0.2131
40	R	A	-0.5967
41	V	A	-0.2514
42	Y	A	0.0000
43	V	A	0.0000
44	E	A	-1.0900
45	E	A	-1.0745
46	L	A	0.0000
47	K	A	-1.5514
48	P	A	-1.7909
49	T	A	-1.5346
50	P	A	-1.5309
51	E	A	-2.4311
52	G	A	-2.2332
53	D	A	-2.1458
54	L	A	0.0000
55	E	A	-0.8856
56	I	A	0.0000
57	L	A	-1.2814
58	L	A	0.0000
59	Q	A	0.0000
60	K	A	-1.6227
61	W	A	-2.1562
62	E	A	-3.1283
63	N	A	-2.8901
64	G	A	-2.3698
65	E	A	-2.9377
66	C	A	-1.8428
67	A	A	-2.1210
68	Q	A	-2.4866
69	K	A	-2.2465
70	K	A	-2.1401
71	I	A	-0.6811
72	I	A	-0.4173
73	A	A	0.0000
74	E	A	-2.5319
75	K	A	-2.7649
76	T	A	-1.8777
77	K	A	-1.6561
78	I	A	-0.5351
79	P	A	-1.0047
80	A	A	0.0000
81	V	A	0.0000
82	F	A	0.0000
83	K	A	-2.3336
84	I	A	-1.7639
85	D	A	-2.3087
86	A	A	-1.3176
87	L	A	0.3046
88	N	A	-1.5350
89	E	A	-2.6575
90	N	A	-2.0990
91	K	A	-1.6413
92	V	A	0.0000
93	L	A	0.0000
94	V	A	0.0000
95	L	A	0.0000
96	D	A	-1.0729
97	T	A	0.0000
98	D	A	-1.3498
99	Y	A	-1.7179
100	K	A	-2.3253
101	K	A	-1.8567
102	Y	A	0.0000
103	L	A	0.0000
104	L	A	0.0000
105	F	A	0.0000
106	C	A	0.0000
107	M	A	-0.0005
108	E	A	0.0000
109	N	A	-1.4744
110	S	A	-1.3004
111	A	A	-1.6527
112	E	A	-2.5837
113	P	A	-1.7632
114	E	A	-2.8212
115	Q	A	-2.6618
116	S	A	-1.5302
117	L	A	0.0000
118	A	A	0.0000
119	C	A	0.0000
120	Q	A	0.0000
121	C	A	0.0000
122	L	A	0.0000
123	V	A	0.0000
124	R	A	-1.2124
125	T	A	-1.1409
126	P	A	-1.3796
127	E	A	-1.9706
128	V	A	-0.7997
129	D	A	-1.9950
130	D	A	-3.3047
131	E	A	-3.5612
132	A	A	0.0000
133	L	A	-2.5045
134	E	A	-3.9626
135	K	A	-3.1861
136	F	A	0.0000
137	D	A	-3.1007
138	K	A	-2.9400
139	A	A	-1.9571
140	L	A	0.0000
141	K	A	-2.2513
142	A	A	-1.0580
143	L	A	-0.8470
144	P	A	-0.9929
145	M	A	-0.9449
146	H	A	-0.7175
147	I	A	-0.5025
148	R	A	-1.1672
149	L	A	-0.5625
150	S	A	-0.3452
151	F	A	0.0000
152	N	A	-1.1967
153	P	A	-1.4935
154	T	A	-1.3286
155	Q	A	-1.2201
156	L	A	0.0000
157	E	A	-2.9499
158	E	A	-2.4861
159	Q	A	-2.0315
160	C	A	0.0000
161	H	A	0.0000
162	I	A	0.8159