Project name: PRL_1

Status: done

Started: 2026-07-28 01:05:28
Settings
Chain sequence(s) A: LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:28)
Show buried residues

Minimal score value
-4.4026
Maximal score value
2.2858
Average score
-1.0207
Total score value
-203.1162

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.9192
2 P A 1.4120
3 I A 2.2858
4 C A 0.7994
5 P A 0.0896
6 G A -0.5292
7 G A -0.8883
8 A A -1.0218
9 A A -1.0082
10 R A -1.7874
11 C A -0.7279
12 Q A -0.2809
13 V A 1.0246
14 T A -0.0081
15 L A -0.5425
16 R A -1.8577
17 D A -1.3852
18 L A -0.9187
19 F A 0.0000
20 D A -1.9083
21 R A -1.9953
22 A A 0.0000
23 V A -0.2213
24 V A 0.9506
25 L A 0.2999
26 S A 0.0000
27 H A -0.1886
28 Y A 0.5902
29 I A 0.0000
30 H A -1.8658
31 N A -2.0306
32 L A 0.0000
33 S A 0.0000
34 S A -2.1883
35 E A -2.7464
36 M A 0.0000
37 F A 0.0000
38 S A -2.3275
39 E A -2.5371
40 F A 0.0000
41 D A -2.3817
42 K A -3.3196
43 R A -3.0786
44 Y A -2.2729
45 T A 0.0000
46 H A -2.7391
47 G A -1.4922
48 R A -1.1614
49 G A -0.1994
50 F A 0.9931
51 I A 0.0463
52 T A -0.2633
53 K A -1.1639
54 A A -0.7617
55 I A -0.6271
56 N A -1.7151
57 S A -0.9471
58 C A 0.0000
59 H A -0.3852
60 T A 0.0000
61 S A -0.7901
62 S A -0.0696
63 L A 0.3738
64 A A -0.4030
65 T A -0.9758
66 P A 0.0000
67 E A -3.3276
68 D A -4.1660
69 K A -4.2508
70 E A -4.4026
71 Q A -4.0811
72 A A -3.7371
73 Q A -3.6593
74 Q A -3.3416
75 M A -2.7664
76 N A -2.8492
77 Q A -2.7666
78 K A -2.1572
79 D A -2.1012
80 F A 0.0000
81 L A 0.0000
82 S A -0.8828
83 L A 0.0000
84 I A 0.0000
85 V A 0.0000
86 S A 0.0000
87 I A 0.0000
88 L A 0.0000
89 R A -0.3234
90 S A 0.3441
91 W A 0.0000
92 N A -1.2936
93 E A -0.8691
94 P A 0.0000
95 L A 0.0000
96 Y A 0.5935
97 H A -0.0418
98 L A 0.0000
99 V A -0.4279
100 T A -0.4664
101 E A -1.1051
102 V A 0.0000
103 R A -2.8228
104 G A -2.1618
105 M A -2.1800
106 Q A -2.7576
107 E A -3.0323
108 A A 0.0000
109 P A -2.5608
110 E A -2.6125
111 A A -1.5123
112 I A 0.0000
113 L A -1.3158
114 S A -1.1316
115 K A -1.7020
116 A A 0.0000
117 V A -0.8507
118 E A -1.7024
119 I A 0.0000
120 E A -1.7929
121 E A -2.6678
122 Q A -1.9166
123 T A 0.0000
124 K A -3.0525
125 R A -3.5217
126 L A 0.0000
127 L A 0.0000
128 E A -2.7824
129 G A 0.0000
130 M A 0.0000
131 E A -2.1001
132 L A -0.6055
133 I A 0.0000
134 V A 0.0000
135 S A -1.8712
136 Q A -1.3145
137 V A -0.4166
138 H A -1.5548
139 P A -2.0360
140 E A -2.8867
141 T A -2.8641
142 K A -3.4900
143 E A -3.3870
144 N A -2.1375
145 E A -0.9233
146 I A 1.7885
147 Y A 2.0251
148 P A 1.6229
149 V A 1.9822
150 W A 0.7653
151 S A 0.1572
152 G A -0.0814
153 L A -0.2568
154 P A -0.3947
155 S A -0.5157
156 L A -0.5468
157 Q A -1.3570
158 M A -1.3181
159 A A -1.5627
160 D A -2.9143
161 E A -2.6805
162 E A -2.3482
163 S A -1.8480
164 R A -1.6981
165 L A 0.0000
166 S A -0.4969
167 A A 0.0000
168 Y A 0.0000
169 Y A 0.0000
170 N A -0.6498
171 L A 0.0000
172 L A 0.0000
173 H A -1.3347
174 C A 0.0000
175 L A 0.0000
176 R A -2.7355
177 R A -2.9686
178 D A 0.0000
179 S A 0.0000
180 H A -2.1686
181 K A -1.6877
182 I A 0.0000
183 D A 0.0000
184 N A -1.0030
185 Y A 0.0000
186 L A 0.0000
187 K A -1.2672
188 L A -0.8491
189 L A -0.9202
190 K A -1.7927
191 C A -2.0017
192 R A -2.5043
193 I A -1.2924
194 I A -1.4576
195 H A -2.4309
196 N A -2.8347
197 N A -2.5447
198 N A -1.7336
199 C A -0.5908
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018