Project name: query_structure

Status: done

Started: 2026-03-17 01:05:32
Settings
Chain sequence(s) A: DCYCRIPACIAGERRYGTCIYQGRLWAFCC
B: DCYCRIPACIAGERRYGTCIYQGRLWAFCC
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:27)
Show buried residues

Minimal score value
-2.2754
Maximal score value
2.2757
Average score
-0.0783
Total score value
-4.6952

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 D A -1.4602
3 C A -0.5554
4 Y A 0.0202
5 C A 0.7186
6 R A 0.6074
7 I A 0.9697
8 P A 0.6996
9 A A 0.2021
10 C A 0.3466
11 I A 1.4368
12 A A 0.4671
13 G A -0.3949
14 E A -1.0795
15 R A -2.2754
16 R A -1.9625
17 Y A -0.5385
18 G A -0.5466
19 T A 0.8190
20 C A 0.0000
21 I A 1.1336
22 Y A -0.0705
23 Q A -1.1856
24 G A -1.1627
25 R A -1.1724
26 L A 0.9547
27 W A 0.6195
28 A A 0.0000
29 F A 0.0000
30 C A 0.0000
31 C A -0.6647
2 D B -1.5644
3 C B -0.6984
4 Y B 0.0598
5 C B 0.5587
6 R B 1.0848
7 I B 2.2757
8 P B 1.4003
9 A B 0.6139
10 C B 0.5970
11 I B 1.6589
12 A B 0.5035
13 G B -0.3700
14 E B -0.9720
15 R B -2.1394
16 R B -1.7860
17 Y B -0.0985
18 G B 0.0990
19 T B 0.9340
20 C B 0.0000
21 I B 0.6827
22 Y B -0.4049
23 Q B -1.3940
24 G B -1.3672
25 R B -1.3958
26 L B 0.9374
27 W B 0.9421
28 A B 0.0000
29 F B 0.0000
30 C B 0.0000
31 C B -0.7784
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018