Project name: obj1 [mutate: EA1C, LR4C, SN7C, GR15C, SC25C, WQ36C, WG47C, GI53C, DK62C, RM67C, DF73C, YS80C, SP85C, TH91C, RN98C, GR106C, DV108C, SY119C, GT113C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	YS80C,TH91C,WG47C,GI53C,SP85C,SC25C,RM67C,DF73C,RN98C,DK62C,DV108C,SY119C,GT113C,EA1C,WQ36C,SN7C,GR106C,GR15C,LR4C
Energy difference between WT (input) and mutated protein (by FoldX)	43.6936 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:05:28)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:02)

• Minimal score value: -3.879
• Maximal score value: 1.7956
• Average score: -0.5764
• Total score value: -69.1651

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	C	0.1613	mutated: EA1C
2	V	C	0.4797
3	Q	C	-0.6006
4	R	C	0.0000	mutated: LR4C
5	V	C	0.0256
6	E	C	0.0000
7	N	C	-1.6332	mutated: SN7C
8	G	C	-1.4636
9	G	C	-0.4464
10	G	C	0.4864
11	L	C	1.3060
12	V	C	0.0033
13	Q	C	-1.0682
14	P	C	-1.3841
15	R	C	-2.4915	mutated: GR15C
16	G	C	-1.4797
17	S	C	-1.3479
18	L	C	-0.9668
19	R	C	-2.2871
20	L	C	0.0000
21	S	C	-1.0816
22	C	C	0.0000
23	A	C	-0.3406
24	A	C	0.0000
25	C	C	0.9388	mutated: SC25C
26	D	C	0.0000
27	F	C	1.7956
28	T	C	0.5036
29	F	C	0.0000
30	R	C	-1.4627
31	S	C	-0.4985
32	Y	C	-0.7594
33	E	C	-0.7766
34	M	C	0.0000
35	S	C	0.0000
36	Q	C	0.0000	mutated: WQ36C
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.5796
40	A	C	-1.1388
41	P	C	-1.3568
42	G	C	-1.4527
43	K	C	-2.1806
44	G	C	-1.1678
45	L	C	-0.0651
46	E	C	-0.9310
47	G	C	-0.5833	mutated: WG47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.3848
51	I	C	0.0000
52	S	C	-0.1553
53	I	C	-0.3217	mutated: GI53C
54	S	C	-0.6072
55	G	C	-0.5919
56	G	C	-0.6149
57	S	C	-0.1320
58	T	C	0.3696
59	Y	C	0.9504
60	Y	C	-0.2488
61	A	C	-1.1794
62	K	C	-2.1789	mutated: DK62C
63	S	C	-1.5817
64	V	C	0.0000
65	K	C	-2.2359
66	G	C	-1.5066
67	M	C	-0.8286	mutated: RM67C
68	F	C	0.0000
69	T	C	-0.5443
70	I	C	0.0000
71	S	C	-0.1513
72	R	C	-0.3502
73	F	C	0.0054	mutated: DF73C
74	N	C	-1.2213
75	S	C	-1.2081
76	K	C	-1.7275
77	N	C	-0.9534
78	T	C	-0.5626
79	L	C	0.0000
80	S	C	-0.5886	mutated: YS80C
81	L	C	0.0000
82	Q	C	-1.0715
83	M	C	0.0000
84	N	C	-1.3048
85	P	C	-1.5058	mutated: SP85C
86	L	C	0.0000
87	R	C	-1.6045
88	A	C	-1.1929
89	E	C	-1.9353
90	D	C	0.0000
91	H	C	-0.3539	mutated: TH91C
92	A	C	0.0000
93	I	C	0.7509
94	Y	C	0.0000
95	Y	C	0.4405
96	C	C	0.0000
97	A	C	0.0000
98	N	C	0.0000	mutated: RN98C
99	L	C	0.0000
100	R	C	-3.2514
101	D	C	-3.4630
102	G	C	-2.3140
103	F	C	-1.4998
104	N	C	-2.9056
105	K	C	-3.8790
106	R	C	-3.3910	mutated: GR106C
107	F	C	-1.4234
108	V	C	-0.1394	mutated: DV108C
109	Y	C	0.5146
110	W	C	0.7625
111	G	C	-0.1453
112	Q	C	-1.0803
113	T	C	-0.1292	mutated: GT113C
114	T	C	0.1429
115	L	C	1.3074
116	V	C	0.0000
117	T	C	0.5251
118	V	C	0.0000
119	Y	C	0.7731	mutated: SY119C
120	S	C	-0.1681