| Chain sequence(s) |
A: GSSSVSVSCPDGYIYSSNTASGYDCGVWICRRVGSAFCSRTGDYTSPSVSVSSGSE
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:08)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:08)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:08)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:08)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:08)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:00:27)
[INFO] Auto_mut: Residue number 5 from chain A and a score of 2.566 (valine) selected for
automated muatation (00:00:29)
[INFO] Auto_mut: Residue number 49 from chain A and a score of 2.451 (valine) selected for
automated muatation (00:00:29)
[INFO] Auto_mut: Residue number 51 from chain A and a score of 2.402 (valine) selected for
automated muatation (00:00:29)
[INFO] Auto_mut: Residue number 50 from chain A and a score of 1.947 (serine) selected for
automated muatation (00:00:29)
[INFO] Auto_mut: Residue number 27 from chain A and a score of 1.866 (valine) selected for
automated muatation (00:00:29)
[INFO] Auto_mut: Residue number 6 from chain A and a score of 1.674 (serine) selected for
automated muatation (00:00:29)
[INFO] Auto_mut: Mutating residue number 5 from chain A (valine) into glutamic acid (00:00:29)
[INFO] Auto_mut: Mutating residue number 5 from chain A (valine) into aspartic acid (00:00:29)
[INFO] Auto_mut: Mutating residue number 49 from chain A (valine) into glutamic acid (00:00:29)
[INFO] Auto_mut: Mutating residue number 5 from chain A (valine) into arginine (00:00:52)
[INFO] Auto_mut: Mutating residue number 5 from chain A (valine) into lysine (00:00:55)
[INFO] Auto_mut: Mutating residue number 49 from chain A (valine) into lysine (00:00:57)
[INFO] Auto_mut: Mutating residue number 49 from chain A (valine) into aspartic acid (00:01:26)
[INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into glutamic acid (00:01:39)
[INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into aspartic acid (00:01:39)
[INFO] Auto_mut: Mutating residue number 49 from chain A (valine) into arginine (00:01:48)
[INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into arginine (00:02:02)
[INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into lysine (00:02:02)
[INFO] Auto_mut: Mutating residue number 50 from chain A (serine) into glutamic acid (00:02:20)
[INFO] Auto_mut: Mutating residue number 50 from chain A (serine) into aspartic acid (00:02:32)
[INFO] Auto_mut: Mutating residue number 27 from chain A (valine) into glutamic acid (00:02:40)
[INFO] Auto_mut: Mutating residue number 50 from chain A (serine) into lysine (00:02:46)
[INFO] Auto_mut: Mutating residue number 50 from chain A (serine) into arginine (00:02:55)
[INFO] Auto_mut: Mutating residue number 27 from chain A (valine) into lysine (00:03:05)
[INFO] Auto_mut: Mutating residue number 27 from chain A (valine) into aspartic acid (00:03:26)
[INFO] Auto_mut: Mutating residue number 6 from chain A (serine) into glutamic acid (00:03:26)
[INFO] Auto_mut: Mutating residue number 6 from chain A (serine) into aspartic acid (00:03:41)
[INFO] Auto_mut: Mutating residue number 27 from chain A (valine) into arginine (00:03:48)
[INFO] Auto_mut: Mutating residue number 6 from chain A (serine) into lysine (00:03:52)
[INFO] Auto_mut: Mutating residue number 6 from chain A (serine) into arginine (00:04:03)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (valine) into glutamic
acid: Energy difference: 0.3060 kcal/mol, Difference in average score from
the base case: -0.2867 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (valine) into lysine:
Energy difference: -0.2305 kcal/mol, Difference in average score from the
base case: -0.2866 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (valine) into aspartic
acid: Energy difference: 1.3459 kcal/mol, Difference in average score from
the base case: -0.2849 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (valine) into arginine:
Energy difference: -0.2715 kcal/mol, Difference in average score from the
base case: -0.2941 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 49 from chain A (valine) into glutamic
acid: Energy difference: 0.2183 kcal/mol, Difference in average score from
the base case: -0.2880 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 49 from chain A (valine) into lysine:
Energy difference: -0.2943 kcal/mol, Difference in average score from the
base case: -0.2876 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 49 from chain A (valine) into aspartic
acid: Energy difference: 0.9591 kcal/mol, Difference in average score from
the base case: -0.2780 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 49 from chain A (valine) into arginine:
Energy difference: -0.2613 kcal/mol, Difference in average score from the
base case: -0.3225 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into glutamic
acid: Energy difference: 0.1509 kcal/mol, Difference in average score from
the base case: -0.2937 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into lysine:
Energy difference: -0.7632 kcal/mol, Difference in average score from the
base case: -0.2506 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into aspartic
acid: Energy difference: 0.1787 kcal/mol, Difference in average score from
the base case: -0.2566 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into arginine:
Energy difference: -0.8287 kcal/mol, Difference in average score from the
base case: -0.2578 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 50 from chain A (serine) into glutamic
acid: Energy difference: -0.3122 kcal/mol, Difference in average score from
the base case: -0.1081 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 50 from chain A (serine) into lysine:
Energy difference: -0.3938 kcal/mol, Difference in average score from the
base case: -0.1440 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 50 from chain A (serine) into aspartic
acid: Energy difference: 0.0855 kcal/mol, Difference in average score from
the base case: -0.1081 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 50 from chain A (serine) into arginine:
Energy difference: -0.2723 kcal/mol, Difference in average score from the
base case: -0.1544 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 27 from chain A (valine) into glutamic
acid: Energy difference: -0.4872 kcal/mol, Difference in average score from
the base case: -0.2555 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 27 from chain A (valine) into lysine:
Energy difference: -0.3020 kcal/mol, Difference in average score from the
base case: -0.2905 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 27 from chain A (valine) into aspartic
acid: Energy difference: 0.2457 kcal/mol, Difference in average score from
the base case: -0.2644 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 27 from chain A (valine) into arginine:
Energy difference: -0.1887 kcal/mol, Difference in average score from the
base case: -0.3072 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 6 from chain A (serine) into glutamic
acid: Energy difference: -0.0866 kcal/mol, Difference in average score from
the base case: -0.1216 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 6 from chain A (serine) into lysine:
Energy difference: -0.2484 kcal/mol, Difference in average score from the
base case: -0.1135 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 6 from chain A (serine) into aspartic
acid: Energy difference: 0.4007 kcal/mol, Difference in average score from
the base case: -0.1208 (00:04:33)
[INFO] Auto_mut: Effect of mutation residue number 6 from chain A (serine) into arginine:
Energy difference: -0.2671 kcal/mol, Difference in average score from the
base case: -0.1235 (00:04:33)
[INFO] Main: Simulation completed successfully. (00:04:38)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | G | A | -0.7659 | |
| 2 | S | A | -0.7390 | |
| 3 | S | A | -0.0082 | |
| 4 | S | A | 0.6910 | |
| 5 | V | A | 2.5659 | |
| 6 | S | A | 1.6741 | |
| 7 | V | A | 1.6326 | |
| 8 | S | A | 0.4576 | |
| 9 | C | A | -0.0111 | |
| 10 | P | A | -1.1622 | |
| 11 | D | A | -1.8125 | |
| 12 | G | A | -0.9044 | |
| 13 | Y | A | -0.2872 | |
| 14 | I | A | 0.7014 | |
| 15 | Y | A | 0.7128 | |
| 16 | S | A | 0.1810 | |
| 17 | S | A | -0.4420 | |
| 18 | N | A | -1.2459 | |
| 19 | T | A | -0.0038 | |
| 20 | A | A | 0.2014 | |
| 21 | S | A | -0.1447 | |
| 22 | G | A | 0.3258 | |
| 23 | Y | A | 0.7416 | |
| 24 | D | A | -0.7264 | |
| 25 | C | A | 0.3997 | |
| 26 | G | A | 0.7049 | |
| 27 | V | A | 1.8663 | |
| 28 | W | A | 0.0000 | |
| 29 | I | A | 1.0830 | |
| 30 | C | A | 0.0000 | |
| 31 | R | A | -0.0849 | |
| 32 | R | A | -1.0215 | |
| 33 | V | A | 0.6219 | |
| 34 | G | A | 0.1891 | |
| 35 | S | A | -0.0774 | |
| 36 | A | A | 0.5234 | |
| 37 | F | A | 1.4632 | |
| 38 | C | A | 0.6761 | |
| 39 | S | A | -0.5956 | |
| 40 | R | A | -1.9314 | |
| 41 | T | A | -1.0259 | |
| 42 | G | A | -1.4598 | |
| 43 | D | A | -1.2584 | |
| 44 | Y | A | -0.2403 | |
| 45 | T | A | -0.2530 | |
| 46 | S | A | 0.1005 | |
| 47 | P | A | 0.5701 | |
| 48 | S | A | 0.6280 | |
| 49 | V | A | 2.4507 | |
| 50 | S | A | 1.9468 | |
| 51 | V | A | 2.4025 | |
| 52 | S | A | 0.5791 | |
| 53 | S | A | -0.2856 | |
| 54 | G | A | -1.1769 | |
| 55 | S | A | -1.5365 | |
| 56 | E | A | -2.0731 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VR51A | -0.8287 | -0.2578 | View | CSV | PDB |
| VK51A | -0.7632 | -0.2506 | View | CSV | PDB |
| VE27A | -0.4872 | -0.2555 | View | CSV | PDB |
| VR49A | -0.2613 | -0.3225 | View | CSV | PDB |
| VK27A | -0.302 | -0.2905 | View | CSV | PDB |
| VK49A | -0.2943 | -0.2876 | View | CSV | PDB |
| VR5A | -0.2715 | -0.2941 | View | CSV | PDB |
| VK5A | -0.2305 | -0.2866 | View | CSV | PDB |
| SK50A | -0.3938 | -0.144 | View | CSV | PDB |
| SR50A | -0.2723 | -0.1544 | View | CSV | PDB |
| SR6A | -0.2671 | -0.1235 | View | CSV | PDB |
| SK6A | -0.2484 | -0.1135 | View | CSV | PDB |
ALA alanine
ARG arginine
ASN asparagine
ASP aspartic acid
CYS cysteine
GLN glutamine
GLU glutamic acid
GLY glycine
HIS histidine
ILE isoleucine
LEU leucine
LYS lysine
MET methionine
PHE phenylalanine
PRO proline
SER serine
THR threonine
TRP tryptophan
TYR tyrosine
VAL valine