Project name: e1e6c71f871394c

Status: done

Started: 2026-04-01 10:26:47
Settings
Chain sequence(s) P: VLTRVRKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAGKKVLGAFSDGLALDNLKGTFATLSELCDKLVDPENFRLLGNVLVCVLAFGKEFTPPVQAAYQKVVAGVANALAKYVLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAGKKVLGAFSDGLALDNLKGTFATLSELCDKLVDPENFRLLGNVLVCVLAFGKEFTPPVQAAYQKVVAGVANALAKY
input PDB
Selected Chain(s) P
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with P chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:09)
Show buried residues

Minimal score value
-3.7464
Maximal score value
1.8704
Average score
-0.8598
Total score value
-235.5887

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V P 0.7920
3 L P 0.0140
4 T P -0.3166
5 R P -1.3538
6 V P 0.4004
7 R P -0.7351
8 K P -0.7082
9 S P -0.5160
10 A P -0.3120
11 V P 0.0000
12 T P -0.4202
13 A P -0.5992
14 L P 0.0000
15 W P -0.7327
16 G P -1.3256
17 K P -1.9115
18 V P -1.5199
19 N P -2.4752
20 V P -2.0633
21 D P -3.0520
22 E P -3.1222
23 V P 0.0000
24 G P 0.0000
25 G P -2.4473
26 E P -1.7758
27 A P 0.0000
28 L P 0.0000
29 G P 0.0000
30 R P -0.4771
31 L P 0.0000
32 L P 0.0000
33 V P 0.7176
34 V P 1.8091
35 Y P 1.2151
36 P P 0.4060
37 W P 0.5915
38 T P 0.0000
39 Q P -0.8322
40 R P -1.6820
41 F P -0.0587
42 F P -1.1445
43 E P -2.3120
44 S P -1.4807
45 F P -1.2945
46 G P -1.9706
47 D P -2.5284
48 L P 0.0000
49 S P -1.1463
50 T P -0.9762
51 P P -0.9004
52 D P -2.0351
53 A P -1.5458
54 V P 0.0000
55 M P -1.1388
56 G P -1.5462
57 N P -1.7347
58 P P -1.5689
59 K P -2.2795
60 V P 0.0000
61 K P -2.9889
62 A P -2.1540
64 G P 0.0000
65 K P -3.1721
66 K P -2.2072
67 V P -0.6096
68 L P 0.0000
69 G P -1.5500
70 A P -0.9462
71 F P 0.0000
72 S P -0.9107
73 D P -1.6730
74 G P 0.0000
75 L P -0.5756
76 A P -0.8336
78 L P -0.9166
79 D P -2.0751
80 N P -2.4228
81 L P 0.0000
82 K P -2.6748
83 G P -1.9316
84 T P -1.5013
85 F P 0.0000
86 A P -1.2653
87 T P -0.6005
88 L P -0.2166
89 S P 0.0000
90 E P -1.7647
91 L P -0.6720
93 C P -0.9796
94 D P -2.1733
95 K P -1.6588
96 L P 0.3887
98 V P -0.5252
99 D P -1.9813
100 P P -1.9009
101 E P -2.7471
102 N P -1.5870
103 F P -1.5494
104 R P -2.6963
105 L P -1.0034
106 L P -0.7679
107 G P 0.0000
108 N P -1.0502
109 V P 0.0000
110 L P 0.0000
111 V P 0.0000
112 C P 0.4743
113 V P 0.3640
114 L P 0.0000
115 A P 0.0282
118 F P 0.0391
119 G P -1.0452
120 K P -2.2075
121 E P -1.8159
122 F P 0.0000
123 T P -1.0922
124 P P -0.9077
125 P P -0.4870
126 V P -0.6332
127 Q P -1.3052
128 A P -1.1041
129 A P 0.0000
130 Y P 0.0000
131 Q P -1.7135
132 K P -1.4514
133 V P 0.0000
134 V P 0.0000
135 A P -1.2451
136 G P -0.8401
137 V P 0.0000
138 A P 0.0000
139 N P -1.9043
140 A P 0.0000
141 L P -0.7260
142 A P -1.2569
144 K P -2.0445
145 Y P -0.5485
1 V P 1.3880
3 L P 0.2984
4 T P 0.3065
5 P P 0.3595
6 V P 1.3361
7 E P -0.0001
8 K P -0.4580
9 S P 0.0955
10 A P 0.0727
11 V P 0.0000
12 T P -0.4933
13 A P -0.4566
14 L P -0.6487
15 W P 0.0000
16 G P -1.3440
17 K P -1.9520
18 V P -1.6529
19 N P -2.6245
20 V P -2.3509
21 D P -3.7464
22 E P -3.4786
23 V P -2.0183
24 G P 0.0000
25 G P -2.6860
26 E P -2.1901
27 A P 0.0000
28 L P -0.5834
29 G P 0.0000
30 R P -0.5264
31 L P 0.0000
32 L P 0.0000
33 V P 0.7477
34 V P 1.8704
35 Y P 1.3239
36 P P 0.3202
37 W P 0.3114
38 T P 0.0000
39 Q P -0.9737
40 R P -1.8328
41 F P -0.0763
42 F P -1.1160
43 E P -2.3552
44 S P -1.5268
45 F P -1.2825
46 G P -1.9503
47 D P -2.5125
48 L P 0.0000
49 S P -1.1176
50 T P -1.0110
51 P P -0.9208
52 D P -2.0437
53 A P -1.5319
54 V P 0.0000
55 M P -1.2985
56 G P -1.6144
57 N P 0.0000
58 P P -1.5678
59 K P -2.2676
60 V P 0.0000
61 K P -3.1002
62 A P -2.2940
64 G P 0.0000
65 K P -3.1186
66 K P -2.1699
67 V P -0.2410
68 L P 0.0000
69 G P -1.4068
70 A P -0.9002
71 F P 0.0000
72 S P -1.0059
73 D P -1.8169
74 G P 0.0000
75 L P 0.0000
76 A P -0.9624
78 L P -1.3563
79 D P -2.4200
80 N P -2.7546
81 L P 0.0000
82 K P -2.8279
83 G P -1.8511
84 T P -1.4888
85 F P 0.0000
86 A P -0.9696
87 T P -0.5141
88 L P 0.0773
89 S P 0.0000
90 E P -1.4776
91 L P -0.3059
93 C P -0.7667
94 D P -2.0327
95 K P -1.5614
96 L P 0.4743
98 V P -0.3448
99 D P -1.6298
100 P P -1.3864
101 E P -2.3153
102 N P 0.0000
103 F P -0.9190
104 R P -1.5792
105 L P -0.4474
106 L P -0.4026
107 G P 0.0000
108 N P -0.9658
109 V P 0.0000
110 L P 0.0000
111 V P 0.0000
112 C P 0.5053
113 V P 0.2056
114 L P 0.0000
115 A P -0.2273
118 F P -0.6040
119 G P -1.5046
120 K P -2.6614
121 E P -2.6178
122 F P 0.0000
123 T P -1.3473
124 P P -0.9718
125 P P -0.3945
126 V P -0.5754
127 Q P -1.2275
128 A P -0.9194
129 A P 0.0000
130 Y P 0.0000
131 Q P -1.5762
132 K P -1.0178
133 V P 0.0000
134 V P 0.0000
135 A P -0.5605
136 G P 0.0000
137 V P 0.0000
138 A P 0.0000
139 N P -0.8846
140 A P 0.0000
141 L P -0.4318
142 A P -0.8876
144 K P -1.7360
145 Y P -0.1834
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018