Project name: GapC192_tagged_rank1_A3D_static_d10

Status: done

Started: 2026-07-24 04:44:08
Settings
Chain sequence(s) A: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGQFVKVSAEREPANIDWATDGVEIVLEATGFFASKEKAEQHIHENGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGALEHHHHHH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)
Show buried residues

Minimal score value
-3.2035
Maximal score value
1.8487
Average score
-0.8541
Total score value
-163.9923

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7800
2 G A -0.2041
3 S A -0.6848
4 S A -1.1532
5 H A -1.9390
6 H A -2.2897
7 H A -2.4602
8 H A -2.4201
9 H A -2.2715
10 H A -1.9105
11 S A -1.1668
12 S A -0.4322
13 G A 0.3998
14 L A 1.8487
15 V A 1.7950
16 P A -0.0808
17 R A -1.6429
18 G A -1.5771
19 S A -1.1477
20 H A -0.6527
21 M A 0.4836
22 A A 0.5134
23 S A 0.5354
24 M A 0.7475
25 T A -0.1153
26 G A -1.0649
27 G A -1.4059
28 Q A -1.9082
29 Q A -1.9562
30 M A -0.7997
31 G A -1.5897
32 R A -2.0596
33 G A -1.0089
34 S A -0.5653
35 M A 0.9637
36 V A 1.0728
37 V A 0.6959
38 K A -0.1488
39 V A 0.0000
40 G A 0.0000
41 I A 0.0000
42 N A 0.0000
43 G A 0.0000
44 F A 0.0000
45 G A -0.8272
46 R A -1.3693
47 I A 0.1183
48 G A 0.0000
49 R A -0.6019
50 L A -0.2579
51 A A -0.3666
52 F A 0.0000
53 R A -1.4371
54 R A -1.9715
55 I A -1.2539
56 Q A -1.9266
57 N A -1.9804
58 V A -1.0957
59 E A -1.5701
60 G A -0.1872
61 V A 0.1672
62 E A -0.4850
63 V A 0.0000
64 T A -0.2906
65 R A 0.0000
66 I A 0.0000
67 N A 0.0000
68 D A -0.3031
69 L A 0.3495
70 T A -0.2622
71 D A -1.4824
72 P A -1.5104
73 N A -1.8903
74 M A -0.5730
75 L A 0.0000
76 A A 0.0000
77 H A -0.5992
78 L A -0.2241
79 L A 0.0000
80 K A -1.2605
81 Y A -0.1621
82 D A -0.9545
83 T A -0.6193
84 T A -1.0867
85 Q A -1.6157
86 G A -1.8165
87 R A -2.4650
88 F A 0.0000
89 D A -2.7201
90 G A -1.9344
91 T A -1.7069
92 V A 0.0000
93 E A -2.0229
94 V A -1.2276
95 K A -2.3352
96 E A -2.7113
97 G A -1.6959
98 G A 0.0000
99 F A 0.0000
100 E A -1.5673
101 V A 0.0000
102 N A -2.1316
103 G A -1.5835
104 Q A -1.3863
105 F A -0.1020
106 V A 0.0000
107 K A -1.1160
108 V A 0.0000
109 S A -0.7142
110 A A -0.6696
111 E A -2.0001
112 R A -2.8700
113 E A -3.2035
114 P A 0.0000
115 A A -2.2484
116 N A -2.6532
117 I A 0.0000
118 D A -1.8674
119 W A 0.0000
120 A A -1.5266
121 T A -0.6915
122 D A -0.8211
123 G A -0.7137
124 V A 0.0000
125 E A -1.2762
126 I A -0.5569
127 V A 0.0000
128 L A 0.3662
129 E A 0.0000
130 A A 0.2091
131 T A 0.3750
132 G A 0.6060
133 F A 1.7058
134 F A 0.0112
135 A A -0.2553
136 S A -1.7158
137 K A -2.7991
138 E A -3.1882
139 K A -2.2517
140 A A 0.0000
141 E A -2.2018
142 Q A -1.8486
143 H A 0.0000
144 I A -1.3238
145 H A -2.0014
146 E A -2.7107
147 N A -2.7170
148 G A -2.2282
149 A A 0.0000
150 K A -2.5334
151 K A -1.5887
152 V A 0.0000
153 V A 0.2664
154 I A 0.0000
155 T A 0.3837
156 A A 0.2909
157 P A -0.7142
158 G A 0.0000
159 G A -1.9375
160 N A -2.6508
161 D A -3.0789
162 V A 0.0000
163 K A -1.2940
164 T A -0.4767
165 V A 0.0000
166 V A 0.3201
167 F A 0.9536
168 N A -0.9830
169 T A -0.6934
170 N A -0.6860
171 H A -0.8517
172 D A -1.5906
173 I A -0.3510
174 L A -0.7878
175 D A -1.8935
176 G A -1.1569
177 T A -0.9438
178 E A -0.8683
179 T A -0.8855
180 V A 0.0000
181 I A -0.3623
182 S A 0.0000
183 G A 0.4195
184 A A 0.5590
185 L A 0.6325
186 E A -1.7890
187 H A -2.3663
188 H A -2.7222
189 H A -2.9666
190 H A -2.6921
191 H A -2.4022
192 H A -1.8989
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018