Project name: query_structure

Status: done

Started: 2026-03-16 21:46:40
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFYIAYAEPRPDGEAILLQVPGSCRSYDLTGLKPGTEYSVLIHGVKGGLLSSPLTAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:35)
Show buried residues

Minimal score value
-3.2713
Maximal score value
2.0621
Average score
-0.6362
Total score value
-57.2601

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3951
2 L A 0.7355
3 P A -0.1119
4 A A -0.3929
5 P A 0.0000
6 K A -2.0702
7 N A -1.4127
8 L A 0.1641
9 V A 1.3036
10 V A 0.8088
11 S A -0.4464
12 R A -1.8081
13 V A -0.6388
14 T A -1.5966
15 E A -2.9909
16 D A -2.7197
17 S A -1.9823
18 A A 0.0000
19 R A -1.1232
20 L A 0.0000
21 S A -0.2230
22 W A 0.0000
23 T A -1.1730
24 A A -1.2933
25 P A -1.4086
26 D A -2.1393
27 A A -1.5070
28 A A -1.3156
29 F A 0.0000
30 D A -2.5411
31 S A -1.4502
32 F A 0.0000
33 Y A 0.4522
34 I A 0.0000
35 A A 1.0423
36 Y A 0.0000
37 A A -0.6729
38 E A -2.0239
39 P A -1.9182
40 R A -3.2713
41 P A -2.4177
42 D A -3.1668
43 G A -2.6391
44 E A -2.1543
45 A A -0.0252
46 I A 1.7546
47 L A 2.0621
48 L A 1.0049
49 Q A -0.6027
50 V A 0.0000
51 P A -0.9645
52 G A 0.0000
53 S A -1.0302
54 C A -0.3979
55 R A -0.6382
56 S A -0.3794
57 Y A -0.6688
58 D A -1.7118
59 L A 0.0000
60 T A -1.3354
61 G A -1.5108
62 L A 0.0000
63 K A -3.0459
64 P A -2.5009
65 G A -1.8630
66 T A -1.9274
67 E A -1.5626
68 Y A 0.0000
69 S A 0.2248
70 V A 0.0000
71 L A 1.0748
72 I A 0.0000
73 H A 0.1614
74 G A 0.0000
75 V A -0.6599
76 K A -1.6640
77 G A -1.2048
78 G A -0.5566
79 L A 0.7774
80 L A 1.2113
81 S A 0.0000
82 S A 0.4339
83 P A -0.0585
84 L A -0.2682
85 T A 0.4880
86 A A 1.3643
87 I A 1.9419
88 F A 0.0000
89 T A -0.6890
90 T A -1.7864
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018