Project name: e291e27392cd664

Status: done

Started: 2026-05-13 09:56:38
Settings
Chain sequence(s) A: MTTITINTYDPEARFNMSGEEAKEFFAFVEEQAKVSGFDVCYDSCTYVDEESERFVEKCFQNY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage No
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)
Show buried residues

Minimal score value
-4.2019
Maximal score value
0.8329
Average score
-1.2287
Total score value
-77.408

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8329
2 T A 0.1976
3 T A -0.3707
4 I A 0.0000
5 T A -0.3494
6 I A 0.0000
7 N A 0.0000
8 T A -0.4062
9 Y A 0.3175
10 D A -1.5931
11 P A -2.3173
12 E A -2.9948
13 A A -1.7628
14 R A -1.6592
15 F A -1.7488
16 N A -2.4347
17 M A -2.5300
18 S A -2.7782
19 G A -3.1822
20 E A -3.8521
21 E A -4.2019
22 A A 0.0000
23 K A -3.8013
24 E A -3.5203
25 F A 0.0000
26 F A 0.0000
27 A A -1.7036
28 F A -0.9741
29 V A 0.0000
30 E A -1.5604
31 E A -2.2905
32 Q A -1.2234
33 A A 0.0000
34 K A -2.0082
35 V A -0.0173
36 S A -0.5314
37 G A -0.6563
38 F A -0.5117
39 D A -1.0952
40 V A -0.6524
41 C A 0.4211
42 Y A 0.7064
43 D A -0.1307
44 S A 0.0771
45 C A 0.5187
46 T A 0.6476
47 Y A 0.8243
48 V A 0.0000
49 D A -2.1686
50 E A -3.1733
51 E A -3.0060
52 S A 0.0000
53 E A -3.1305
54 R A -3.9327
55 F A -2.5581
56 V A 0.0000
57 E A -3.4385
58 K A -3.3301
59 C A 0.0000
60 F A -0.9191
61 Q A -1.9829
62 N A -1.5688
63 Y A 0.1156
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018