Project name: e3244fc608127c3

Status: done

Started: 2026-03-05 05:22:26
Settings
Chain sequence(s) A: SKLEEILKQIEEQYDFMKSWLGYEELKKEAEKAGEKAKEKFKELAEKKSLNEATKEVSREIYKDFVDLFEKQVKLDE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:09:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:06)
Show buried residues

Minimal score value
-5.2394
Maximal score value
0.3968
Average score
-2.2231
Total score value
-171.1793

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -1.9201
2 K A -2.8403
3 L A -2.2268
4 E A -3.5900
5 E A -3.8891
6 I A -2.9905
7 L A -3.4513
8 K A -4.4637
9 Q A -4.0150
10 I A 0.0000
11 E A -4.4343
12 E A -3.6611
13 Q A -1.9293
14 Y A 0.0000
15 D A -2.7209
16 F A 0.1795
17 M A 0.0000
18 K A -1.9461
19 S A -0.2469
20 W A 0.3391
21 L A 0.0000
22 G A -1.1853
23 Y A -1.9898
24 E A -3.5187
25 E A -3.9222
26 L A 0.0000
27 K A -4.0491
28 K A -4.7812
29 E A -4.2729
30 A A 0.0000
31 E A -5.2394
32 K A -4.4503
33 A A -3.5738
34 G A 0.0000
35 E A -4.6288
36 K A -4.3652
37 A A 0.0000
38 K A -3.7966
39 E A -4.1649
40 K A -3.5513
41 F A 0.0000
42 K A -3.6640
43 E A -4.0716
44 L A -3.4356
45 A A -3.0781
46 E A -3.7044
47 K A -3.7027
48 K A -3.2299
49 S A -2.0239
50 L A -1.7535
51 N A -2.1879
52 E A -2.5168
53 A A 0.0000
54 T A -2.2341
55 K A -3.1830
56 E A -3.2087
57 V A 0.0000
58 S A -2.1281
59 R A -2.9828
60 E A -2.5005
61 I A -0.9456
62 Y A -0.3043
63 K A -1.8336
64 D A -1.3252
65 F A 0.3968
66 V A -0.1197
67 D A -1.7210
68 L A 0.0000
69 F A 0.2716
70 E A -1.3341
71 K A -1.5348
72 Q A -1.1955
73 V A -1.1924
74 K A -2.4108
75 L A -1.4699
76 D A -2.7725
77 E A -2.7864
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018