Project name: e32cefe81575fa2

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLKLSCAASGFTFNKYAMNWVRQAPGKGLEWVARIRSKYQNYATYYADSVKDRFTISRDDSKNTAYLQMNNLKTEDTAVYYCVRHGNFGNSYISYWAYWGQGTLVTV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:10)

• Minimal score value: -3.0258
• Maximal score value: 2.266
• Average score: -0.4978
• Total score value: -61.2308

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
175	E	A	-2.2043
176	V	A	-1.3498
177	Q	A	-1.3939
178	L	A	0.0000
179	V	A	0.9378
180	E	A	0.0000
181	S	A	-0.2058
182	G	A	-0.7565
183	G	A	0.1154
184	G	A	0.7307
185	L	A	1.5720
186	V	A	0.1712
187	Q	A	-1.2525
188	P	A	-1.7179
189	G	A	-1.8557
190	G	A	-1.2306
191	S	A	-1.4240
192	L	A	-0.9798
193	K	A	-1.8123
194	L	A	0.0000
195	S	A	-0.3205
196	C	A	0.0000
197	A	A	-0.1674
198	A	A	0.0000
199	S	A	-1.1056
200	G	A	-1.3245
201	F	A	-0.7566
202	T	A	-0.6338
203	F	A	0.0000
204	N	A	-1.5601
205	K	A	-1.8654
206	Y	A	-0.9313
207	A	A	-0.7505
208	M	A	0.0000
209	N	A	0.0000
210	W	A	0.0000
211	V	A	0.0000
212	R	A	0.0000
213	Q	A	-0.3471
214	A	A	-0.9690
215	P	A	-0.9585
216	G	A	-1.5684
217	K	A	-2.0769
218	G	A	-0.9390
219	L	A	0.6317
220	E	A	-0.1756
221	W	A	0.2432
222	V	A	0.0000
223	A	A	0.0000
224	R	A	-0.3304
225	I	A	0.0000
226	R	A	-1.3638
227	S	A	0.0000
228	K	A	-1.6376
229	Y	A	-0.4853
230	Q	A	-1.6891
231	N	A	-1.6930
232	Y	A	-0.8514
233	A	A	-0.6561
234	T	A	-0.1969
235	Y	A	0.0449
236	Y	A	-0.7824
237	A	A	-1.3186
238	D	A	-2.4797
239	S	A	-1.8280
240	V	A	0.0000
241	K	A	-2.8102
242	D	A	-3.0258
243	R	A	-2.3281
244	F	A	0.0000
245	T	A	-0.9478
246	I	A	0.0000
247	S	A	-0.3387
248	R	A	-0.9552
249	D	A	-1.3844
250	D	A	-1.8565
251	S	A	-1.5266
252	K	A	-2.3421
253	N	A	-1.7148
254	T	A	-0.9588
255	A	A	0.0000
256	Y	A	-0.4146
257	L	A	0.0000
258	Q	A	-1.0121
259	M	A	0.0000
260	N	A	-2.0744
261	N	A	-2.5037
262	L	A	0.0000
263	K	A	-2.3965
264	T	A	-1.6113
265	E	A	-2.1896
266	D	A	0.0000
267	T	A	-0.2930
268	A	A	0.0000
269	V	A	0.8684
270	Y	A	0.0000
271	Y	A	0.5996
272	C	A	0.0000
273	V	A	0.0000
274	R	A	0.0000
275	H	A	0.6481
276	G	A	0.0000
277	N	A	0.3074
278	F	A	1.5783
279	G	A	-0.1100
280	N	A	-0.7504
281	S	A	0.7013
282	Y	A	1.7871
283	I	A	2.2660
284	S	A	1.3366
285	Y	A	1.4698
286	W	A	1.0376
287	A	A	0.6525
288	Y	A	0.4931
289	W	A	0.4679
290	G	A	-0.0455
291	Q	A	-0.6577
292	G	A	0.0000
293	T	A	0.5388
294	L	A	1.3977
295	V	A	0.0000
296	T	A	0.5568
297	V	A	-0.1913