Project name: e3442329b4f6225

Status: done

Started: 2026-06-24 07:55:37
Settings
Chain sequence(s) A: SKIKGSRHWGFILYGKRGEPPPGKPADDAGLVSRHWGFILYGKRGEPPPGKPADDAGLVSRHWGFILYGKRGEPPPGKPADDAGLVSRHWGFILYGKRGEPPPGKPADDAGLVSRHWGFILYGKRGEPPPGKPADDAGLVSRHWGFILYGKRGEPPPGKPADDAGLV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:33)
Show buried residues

Minimal score value
-3.6018
Maximal score value
3.3684
Average score
-1.193
Total score value
-199.2303

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -1.1799
2 K A -2.1607
3 I A -2.0752
4 K A -3.1975
5 G A -3.2641
6 S A -2.6058
7 R A -2.8010
8 H A -1.3545
9 W A 1.0339
10 G A 1.8452
11 F A 3.3684
12 I A 3.0126
13 L A 2.7242
14 Y A 1.2302
15 G A -0.9399
16 K A -2.6209
17 R A -2.6759
18 G A -2.0882
19 E A -2.6532
20 P A -2.5723
21 P A -1.5307
22 P A -1.2181
23 G A -1.2834
24 K A -2.3276
25 P A -1.9812
26 A A -2.2226
27 D A -2.9627
28 D A -3.3931
29 A A -2.2805
30 G A -1.7925
31 L A -0.6968
32 V A -1.2468
33 S A 0.0000
34 R A -1.7374
35 H A 0.0054
36 W A 1.9501
37 G A 0.0000
38 F A 2.5319
39 I A 1.8299
40 L A 0.4602
41 Y A -0.7607
42 G A -2.2366
43 K A -3.6018
44 R A -3.3293
45 G A -2.7342
46 E A -2.6666
47 P A -1.9562
48 P A -1.3690
49 P A -1.2626
50 G A -1.4336
51 K A -2.2600
52 P A -1.9328
53 A A -2.3172
54 D A -2.9517
55 D A -2.6839
56 A A -2.0723
57 G A -1.7545
58 L A -1.6992
59 V A -1.0770
60 S A -1.9068
61 R A -2.1993
62 H A -0.6171
63 W A 0.8307
64 G A 0.0000
65 F A 1.6172
66 I A 1.5654
67 L A 0.4755
68 Y A -0.5148
69 G A -1.5979
70 K A -2.1188
71 R A -2.3363
72 G A -1.6626
73 E A -2.7490
74 P A -2.4855
75 P A -1.6778
76 P A -1.3565
77 G A -1.5228
78 K A -2.8356
79 P A -2.2351
80 A A -2.3218
81 D A -2.9991
82 D A -3.5450
83 A A -2.4359
84 G A -1.9134
85 L A -1.3155
86 V A -1.3629
87 S A -1.8191
88 R A -2.2859
89 H A -0.6635
90 W A 0.8966
91 G A 0.0000
92 F A 1.4528
93 I A 1.2361
94 L A 0.3420
95 Y A -0.4708
96 G A -1.4156
97 K A -2.0692
98 R A -1.7048
99 G A -1.2609
100 E A -2.1847
101 P A -2.0171
102 P A -1.3317
103 P A -1.3395
104 G A -1.5244
105 K A -2.4093
106 P A -1.9370
107 A A -2.2904
108 D A -2.9696
109 D A -2.7323
110 A A -1.7515
111 G A -1.5639
112 L A -1.4619
113 V A -0.3676
114 S A -1.4537
115 R A -1.6740
116 H A -0.0817
117 W A 1.3814
118 G A 0.0000
119 F A 2.0992
120 I A 1.6284
121 L A 0.3438
122 Y A -0.8198
123 G A -1.4283
124 K A -2.4138
125 R A -2.2812
126 G A -1.6499
127 E A -2.6022
128 P A -2.4374
129 P A -1.6191
130 P A -1.3076
131 G A -1.4138
132 K A -2.5658
133 P A -2.0895
134 A A -2.2775
135 D A -3.0075
136 D A -3.2147
137 A A -2.1156
138 G A -0.9169
139 L A 0.1970
140 V A 0.6640
141 S A -0.6231
142 R A -1.7531
143 H A -1.0948
144 W A 0.9058
145 G A 1.6492
146 F A 2.8819
147 I A 2.5860
148 L A 2.4503
149 Y A 1.2989
150 G A -1.0285
151 K A -2.7417
152 R A -3.0957
153 G A -2.2491
154 E A -2.8524
155 P A -1.8778
156 P A -1.3333
157 P A -1.3942
158 G A -1.5956
159 K A -2.3790
160 P A -1.9340
161 A A -1.9649
162 D A -2.9716
163 D A -2.5959
164 A A -0.9968
165 G A -0.0313
166 L A 1.9774
167 V A 2.4228
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018