Project name: e3b6179811e3785

Status: done

Started: 2026-07-01 15:22:40
Settings
Chain sequence(s) B: MKTVSVTRVFTAADAGQRYRWGFSSSPSTAALEASAAANKEVFTLRAVAP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)
Show buried residues

Minimal score value
-2.3944
Maximal score value
1.8141
Average score
-0.2596
Total score value
-12.9789

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.2526
2 K B -0.9859
3 T B 0.0216
4 V B 1.0196
5 S B 0.5742
6 V B 0.9236
7 T B 0.1002
8 R B -0.4351
9 V B 1.2859
10 F B 1.1295
11 T B 0.4737
12 A B 0.2670
13 A B -0.0467
14 D B -0.5683
15 A B -0.8676
16 G B -1.5326
17 Q B -1.7700
18 R B -2.0685
19 Y B -0.8281
20 R B -1.6328
21 W B -0.0290
22 G B 0.3654
23 F B 1.8141
24 S B 0.6944
25 S B 0.1947
26 S B 0.0806
27 P B -0.1811
28 S B -0.3536
29 T B -0.3704
30 A B -0.4027
31 A B -0.0495
32 L B 0.3047
33 E B -1.2867
34 A B -0.3424
35 S B -0.1271
36 A B -0.5660
37 A B -0.9724
38 A B -0.8350
39 N B -1.5331
40 K B -2.3944
41 E B -2.1588
42 V B -0.1459
43 F B 0.1528
44 T B -0.6195
45 L B -0.5626
46 R B -1.3633
47 A B 0.1768
48 V B 1.3563
49 A B 0.6102
50 P B 0.2523
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018