Project name: 2_rank

Status: done

Started: 2026-04-28 13:58:45
Settings
Chain sequence(s) B: SLEALVYELMEKMYFDPWEAWKINGGSRRVTHMTGKEVYEIARKVAEERLKKEE
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:54)
Show buried residues

Minimal score value
-4.6349
Maximal score value
1.1775
Average score
-1.4711
Total score value
-79.44

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.4170
2 L B -0.7995
3 E B -1.6634
4 A B -0.6371
5 L B -0.7100
6 V B 0.0000
7 Y B -0.3728
8 E B -1.8661
9 L B 0.0000
10 M B -0.7317
11 E B -1.7888
12 K B -1.2346
13 M B 0.0000
14 Y B -0.0171
15 F B 1.1775
16 D B -0.1791
17 P B -0.4740
18 W B 0.3052
19 E B -0.7872
20 A B 0.0000
21 W B -1.0920
22 K B -1.6173
23 I B -0.8300
24 N B -1.2150
25 G B -1.3196
26 G B -1.4192
27 S B -1.9033
28 R B -3.0371
29 R B -3.0184
30 V B 0.0000
31 T B -1.0609
32 H B -1.9149
33 M B -1.4038
34 T B -1.3179
35 G B -1.6869
36 K B -2.4598
37 E B -2.3540
38 V B 0.0000
39 Y B -0.9982
40 E B -1.8174
41 I B -1.1047
42 A B 0.0000
43 R B -2.1002
44 K B -2.6678
45 V B -1.8461
46 A B 0.0000
47 E B -3.1714
48 E B -3.8438
49 R B -3.7390
50 L B -3.0178
51 K B -4.5054
52 K B -4.6349
53 E B -4.3356
54 E B -3.8119
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018