Project name: ranjan

Chain sequence(s)	A: VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)

• Minimal score value: -3.0318
• Maximal score value: 1.646
• Average score: -0.791
• Total score value: -44.2975

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	V	A	0.3789
2	R	A	-1.7824
3	E	A	-2.5746
4	V	A	-1.7717
5	C	A	0.0000
6	S	A	-1.7455
7	E	A	-3.0318
8	Q	A	-2.4652
9	A	A	-1.7302
10	E	A	-1.9199
11	T	A	-0.5660
12	G	A	-0.9520
13	P	A	-0.9172
14	C	A	-0.8516
15	R	A	-1.5024
16	A	A	0.0312
17	M	A	1.4700
18	I	A	1.2933
19	S	A	0.5075
20	R	A	-0.4926
21	W	A	-0.8032
22	Y	A	-0.8947
23	F	A	0.0000
24	D	A	-0.9518
25	V	A	0.2255
26	T	A	-0.5122
27	E	A	-1.9367
28	G	A	-1.2748
29	K	A	-1.7820
30	C	A	-1.1117
31	A	A	-0.8335
32	P	A	-0.2344
33	F	A	0.7366
34	F	A	1.6460
35	Y	A	0.0000
36	G	A	0.0000
37	G	A	-0.2897
38	C	A	-0.6958
39	G	A	-1.0653
40	G	A	-1.8061
41	N	A	-2.1237
42	R	A	-2.5795
43	N	A	0.0000
44	N	A	-1.6038
45	F	A	0.0000
46	D	A	-2.1055
47	T	A	-1.6848
48	E	A	-2.1375
49	E	A	-1.8489
50	Y	A	-0.1664
51	C	A	0.0000
52	M	A	-0.2688
53	A	A	0.3054
54	V	A	0.7189
55	C	A	0.0000
56	G	A	-0.5969