Project name: e41ab42d9aae3a1

Chain sequence(s)	A: MAEVQLQASGGGFVQPGGSLRLSCAASGTTSFGNTMGWDRIAPGKNREFVSAISRQGDDSHHYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAPYYCIEWMNTRREFITVYGGQGTVVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)

• Minimal score value: -3.4064
• Maximal score value: 1.7667
• Average score: -0.9353
• Total score value: -115.9789

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.5234
2	A	A	-0.6191
3	E	A	-1.8736
4	V	A	-1.3225
5	Q	A	-2.0181
6	L	A	0.0000
7	Q	A	-1.7351
8	A	A	-0.8469
9	S	A	-0.7317
10	G	A	-0.6894
11	G	A	0.2682
12	G	A	0.9293
13	F	A	1.7511
14	V	A	0.0000
15	Q	A	-1.3838
16	P	A	-1.6632
17	G	A	-1.4602
18	G	A	-0.9736
19	S	A	-1.1460
20	L	A	-0.9517
21	R	A	-2.2482
22	L	A	0.0000
23	S	A	-0.8523
24	C	A	0.0000
25	A	A	-1.1714
26	A	A	-1.2359
27	S	A	-1.5534
28	G	A	-1.1743
29	T	A	-0.5875
30	T	A	-0.4750
31	S	A	-0.5394
32	F	A	-1.0069
33	G	A	-1.2113
34	N	A	-1.0888
35	T	A	-0.8288
36	M	A	0.0000
37	G	A	0.0000
38	W	A	0.0000
39	D	A	0.0000
40	R	A	0.0000
41	I	A	-0.8483
42	A	A	-1.4787
43	P	A	-1.2425
44	G	A	-1.7538
45	K	A	-2.9603
46	N	A	-2.9386
47	R	A	-2.4886
48	E	A	-1.6651
49	F	A	-0.4735
50	V	A	0.0000
51	S	A	0.0000
52	A	A	0.0000
53	I	A	0.0000
54	S	A	-2.1160
55	R	A	-2.9778
56	Q	A	-2.8573
57	G	A	-2.9051
58	D	A	-3.4064
59	D	A	-3.2564
60	S	A	-2.6064
61	H	A	-2.0023
62	H	A	-1.7266
63	Y	A	-1.3587
64	A	A	-1.5190
65	D	A	-2.5299
66	S	A	-1.7557
67	V	A	0.0000
68	K	A	-2.7302
69	G	A	-1.7059
70	R	A	-1.4306
71	F	A	0.0000
72	T	A	-1.0985
73	I	A	0.0000
74	S	A	-0.9602
75	R	A	-1.5055
76	D	A	-2.1668
77	N	A	-2.7039
78	S	A	-2.0210
79	K	A	-2.6957
80	N	A	-2.1972
81	T	A	0.0000
82	V	A	0.0000
83	Y	A	-0.7098
84	L	A	0.0000
85	Q	A	-1.5681
86	M	A	0.0000
87	N	A	-1.3719
88	S	A	-1.2161
89	L	A	0.0000
90	R	A	-2.4151
91	A	A	-1.7972
92	E	A	-2.2696
93	D	A	0.0000
94	T	A	-0.2938
95	A	A	0.0000
96	P	A	0.6813
97	Y	A	0.0000
98	Y	A	0.0673
99	C	A	0.0000
100	I	A	0.0000
101	E	A	0.0000
102	W	A	0.7681
103	M	A	0.0000
104	N	A	-1.5250
105	T	A	-1.8949
106	R	A	-3.1330
107	R	A	-3.1739
108	E	A	-1.9449
109	F	A	0.5741
110	I	A	0.9070
111	T	A	0.8841
112	V	A	0.6955
113	Y	A	0.4539
114	G	A	0.0000
115	G	A	-1.2954
116	Q	A	-1.3319
117	G	A	-0.4969
118	T	A	0.1568
119	V	A	1.7667
120	V	A	0.0000
121	T	A	0.4558
122	V	A	0.0000
123	S	A	-0.4935
124	S	A	-0.4599