Project name: e47661617931f6b

Status: done

Started: 2026-06-27 10:25:38
Settings
Chain sequence(s) A: MSHHHHHHSGLLEELKEKIKKVMEKGLEKLKEVYATGKPGWKIYDEILEVLEEMLEEIKKVLEEYAPKLNLPGWEEKFPELKEEMMRTFHKFFFDHGLFYAPSDYELEEAFEKMFKVIEEFIEELLKESNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:10:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:10:09)
Show buried residues

Minimal score value
-4.3145
Maximal score value
2.4587
Average score
-1.7705
Total score value
-231.9323

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2418
2 S A -1.1038
3 H A -2.1308
4 H A -2.4669
5 H A -2.6422
6 H A -2.8081
7 H A -2.7630
8 H A -2.7418
9 S A -2.1358
10 G A -2.2131
11 L A -2.2092
12 L A -2.5159
13 E A -3.5147
14 E A -3.8128
15 L A 0.0000
16 K A -3.1305
17 E A -4.1282
18 K A -3.5961
19 I A 0.0000
20 K A -3.3489
21 K A -3.1743
22 V A 0.0000
23 M A 0.0000
24 E A -3.7581
25 K A -3.6339
26 G A 0.0000
27 L A -3.0974
28 E A -4.2180
29 K A -3.5603
30 L A 0.0000
31 K A -3.0966
32 E A -2.9169
33 V A -1.9271
34 Y A 0.0000
35 A A -1.3976
36 T A -0.9646
37 G A -0.9269
38 K A -0.8682
39 P A 0.5726
40 G A 0.0000
41 W A 1.0304
42 K A -1.3277
43 I A 0.0000
44 Y A -1.0717
45 D A -2.7999
46 E A -3.3924
47 I A 0.0000
48 L A -2.2472
49 E A -3.7331
50 V A 0.0000
51 L A 0.0000
52 E A -4.1429
53 E A -4.1831
54 M A 0.0000
55 L A 0.0000
56 E A -4.3145
57 E A -4.0232
58 I A 0.0000
59 K A -3.7416
60 K A -3.9964
61 V A 0.0000
62 L A 0.0000
63 E A -4.0822
64 E A -3.5004
65 Y A -2.5313
66 A A 0.0000
67 P A -2.2691
68 K A -2.7982
69 L A 0.0000
70 N A -2.3129
71 L A 0.0000
72 P A -1.6754
73 G A -2.1665
74 W A 0.0000
75 E A -3.6143
76 E A -3.4515
77 K A -2.8960
78 F A 0.0000
79 P A -2.8727
80 E A -3.7304
81 L A 0.0000
82 K A -3.3870
83 E A -3.7328
84 E A -3.4817
85 M A 0.0000
86 M A -2.5747
87 R A -3.3044
88 T A -2.4340
89 F A 0.0000
90 H A -1.4215
91 K A -2.0823
92 F A 0.0000
93 F A 0.0000
94 F A 0.9049
95 D A -1.0584
96 H A -0.2867
97 G A 0.0000
98 L A 1.7753
99 F A 2.4587
100 Y A 1.4233
101 A A 0.1571
102 P A 0.0000
103 S A -0.8376
104 D A -2.2096
105 Y A -0.6635
106 E A -1.6943
107 L A 0.0000
108 E A -3.4054
109 E A -3.3859
110 A A 0.0000
111 F A 0.0000
112 E A -3.9905
113 K A -3.4394
114 M A 0.0000
115 F A -2.1156
116 K A -2.4212
117 V A -2.1284
118 I A 0.0000
119 E A -2.5091
120 E A -3.2981
121 F A 0.0000
122 I A 0.0000
123 E A -4.0384
124 E A -4.2379
125 L A 0.0000
126 L A -3.1954
127 K A -4.0752
128 E A -3.9986
129 S A -2.9055
130 N A -2.6533
131 S A -1.8537
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018