Project name: e504eae7894b13b

Status: done

Started: 2026-03-30 07:14:15
Settings
Chain sequence(s) A: KKFIKELLEQGYSKEETAIKVVQKFNVSVVVVTDDEEKAKEIAEYIKKNVPSATVVVYENLIVAKVESHEESTKVWELAQKAY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-4.3633
Maximal score value
0.7296
Average score
-1.3984
Total score value
-116.07

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -2.7176
2 K A -2.9882
3 F A -1.9454
4 I A 0.0000
5 K A -3.2183
6 E A -2.9684
7 L A -1.9696
8 L A -1.9603
9 E A -2.9310
10 Q A -2.4236
11 G A -1.5310
12 Y A -1.0671
13 S A -1.3599
14 K A -1.4503
15 E A -1.9661
16 E A -1.4869
17 T A 0.0000
18 A A 0.0000
19 I A 0.5140
20 K A -0.8324
21 V A 0.0000
22 V A -0.1055
23 Q A -1.5052
24 K A -1.8110
25 F A -0.7665
26 N A -1.6165
27 V A 0.0000
28 S A -0.7730
29 V A 0.0000
30 V A 0.7296
31 V A 0.0000
32 V A -0.7631
33 T A -1.8695
34 D A -2.8745
35 D A -3.7381
36 E A -4.2357
37 E A -4.3633
38 K A -3.7535
39 A A 0.0000
40 K A -3.6628
41 E A -3.6354
42 I A 0.0000
43 A A 0.0000
44 E A -3.1804
45 Y A -1.8651
46 I A 0.0000
47 K A -2.2819
48 K A -2.6539
49 N A -1.7217
50 V A 0.0000
51 P A -1.3473
52 S A -1.1539
53 A A 0.0000
54 T A -0.5027
55 V A -0.1662
56 V A 0.1047
57 V A -0.9424
58 Y A 0.0000
59 E A -2.7083
60 N A -2.6516
61 L A 0.0000
62 I A 0.0000
63 V A 0.0000
64 A A 0.0000
65 K A -1.1138
66 V A -1.7414
67 E A -2.5506
68 S A -2.3755
69 H A -2.5965
70 E A -3.0796
71 E A -2.6040
72 S A -2.0182
73 T A -1.7541
74 K A -2.2386
75 V A 0.0000
76 W A -0.6759
77 E A -1.9087
78 L A 0.0000
79 A A 0.0000
80 Q A -1.0899
81 K A -1.7042
82 A A -0.7214
83 Y A 0.2192
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018