Project name: query_structure

Status: done

Started: 2026-03-16 22:55:41
Settings
Chain sequence(s) A: ATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQIDLTQPHDSTMYYLTLEAKDGGKKKLYEAKVWVKYEEDEYWRMNFKELQEFKPVGDA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:07)
Show buried residues

Minimal score value
-4.2282
Maximal score value
0.5654
Average score
-1.3208
Total score value
-136.0463

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A 0.2125
2 T A 0.0772
3 G A -0.2626
4 V A -0.4657
5 R A -1.6964
6 A A -1.2575
7 V A -1.1646
8 P A -1.2750
9 G A -1.4190
10 N A -1.8608
11 E A -2.4226
12 N A -2.1937
13 S A -1.1025
14 L A -0.0932
15 E A -1.5750
16 I A 0.0000
17 E A -1.9833
18 E A -1.4737
19 L A 0.0000
20 A A 0.0000
21 R A -2.3505
22 F A -1.4818
23 A A 0.0000
24 V A 0.0000
25 D A -3.1617
26 E A -3.0455
27 H A 0.0000
28 N A -3.0807
29 K A -3.9849
30 K A -4.2282
31 E A -3.8599
32 N A -3.1732
33 A A -1.9335
34 L A -0.3733
35 L A 0.0000
36 E A -2.9002
37 F A -1.8557
38 V A -1.3571
39 R A -2.3470
40 V A 0.0000
41 V A -1.0255
42 K A -2.2963
43 A A -1.7787
44 K A -1.6104
45 E A -0.8654
46 Q A -0.3177
47 I A -0.2343
48 D A -0.2822
49 L A 0.5654
50 T A -0.2987
51 Q A -1.3565
52 P A -1.4613
53 H A -2.3128
54 D A -1.7981
55 S A 0.0000
56 T A 0.0000
57 M A -0.3753
58 Y A 0.0000
59 Y A -0.7560
60 L A 0.0000
61 T A -1.1301
62 L A 0.0000
63 E A -1.9187
64 A A 0.0000
65 K A -3.3700
66 D A -2.8200
67 G A -2.1362
68 G A -2.7818
69 K A -3.7827
70 K A -3.5916
71 K A -2.6932
72 L A -1.2225
73 Y A 0.0000
74 E A -1.1045
75 A A 0.0000
76 K A -1.1899
77 V A 0.0000
78 W A -0.4322
79 V A 0.0000
80 K A -1.1468
81 Y A -1.8799
82 E A -3.2119
83 E A -4.0031
84 D A -3.5144
85 E A -2.7982
86 Y A -0.2473
87 W A -0.1096
88 R A -1.7162
89 M A 0.1193
90 N A -0.6488
91 F A -0.2774
92 K A -1.0146
93 E A -1.5862
94 L A 0.0000
95 Q A -1.3750
96 E A -1.5392
97 F A -1.1546
98 K A -1.3042
99 P A -0.9331
100 V A -0.3391
101 G A -1.2212
102 D A -1.8430
103 A A -0.8355
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018