Project name: obj1 [mutate: VF2C, QK3C, VQ5C, VN118C]

Status: done

Started: 2025-02-10 14:31:05
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues QK3C,VF2C,VQ5C,VN118C
Energy difference between WT (input) and mutated protein (by FoldX) 8.90221 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:56)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
Show buried residues

Minimal score value
-3.3402
Maximal score value
1.7871
Average score
-0.7204
Total score value
-86.4486

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.0629
2 F C -1.0461 mutated: VF2C
3 K C -2.1814 mutated: QK3C
4 L C 0.0000
5 Q C -1.5593 mutated: VQ5C
6 E C 0.0000
7 S C -0.8084
8 G C -0.7773
9 G C 0.0366
10 G C 0.9241
11 L C 1.4404
12 V C -0.0388
13 Q C -1.3376
14 P C -1.4898
15 G C -1.4140
16 G C -0.9789
17 S C -1.2311
18 L C -0.9630
19 R C -2.1458
20 L C 0.0000
21 S C -0.8223
22 C C 0.0000
23 A C -0.9849
24 A C 0.0000
25 S C -0.6127
26 D C 0.0000
27 F C 1.5639
28 T C 0.2622
29 F C 0.0000
30 R C -2.0386
31 S C -0.8965
32 Y C -1.2378
33 E C -1.1579
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.2955
40 A C -0.9843
41 P C -1.2937
42 G C -1.4348
43 K C -2.1350
44 G C -1.0592
45 L C 0.3948
46 E C -0.3909
47 W C 0.3405
48 V C 0.0000
49 S C 0.0000
50 A C 0.0000
51 I C 0.0000
52 S C -0.5883
53 G C -1.2524
54 S C -1.2315
55 G C -1.0817
56 G C -0.7342
57 S C -0.3022
58 T C 0.1989
59 Y C 0.6075
60 Y C -0.3559
61 A C -1.1386
62 D C -2.3443
63 S C -1.7150
64 V C 0.0000
65 K C -2.3847
66 G C -1.6175
67 R C 0.0000
68 F C 0.0000
69 T C -0.6722
70 I C 0.0000
71 S C -0.5624
72 R C -1.3626
73 D C -1.9805
74 N C -2.1899
75 S C -1.7905
76 K C -2.3168
77 N C -1.6498
78 T C 0.0000
79 L C 0.0000
80 Y C -0.6488
81 L C 0.0000
82 Q C -1.2337
83 M C 0.0000
84 N C -1.3328
85 S C -1.2325
86 L C 0.0000
87 R C -2.4725
88 A C -1.8896
89 E C -2.3444
90 D C 0.0000
91 T C -0.4216
92 A C 0.0000
93 I C 1.0796
94 Y C 0.0000
95 Y C 0.4095
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.2066
101 D C -3.3402
102 G C -2.0912
103 F C -1.2339
104 N C -2.4298
105 K C -3.1876
106 G C -1.9154
107 F C -1.0044
108 D C -1.1189
109 Y C -0.3207
110 W C 0.2048
111 G C -0.8064
112 Q C -1.4418
113 G C -0.2263
114 T C 0.3491
115 L C 1.7871
116 V C 0.0000
117 T C 0.3367
118 N C 0.0000 mutated: VN118C
119 S C -0.7752
120 S C -1.0605
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018