Project name: obj1 [mutate: VF2C, QK3C, VQ5C, VN118C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	QK3C,VF2C,VQ5C,VN118C
Energy difference between WT (input) and mutated protein (by FoldX)	8.90221 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:56)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)

• Minimal score value: -3.3402
• Maximal score value: 1.7871
• Average score: -0.7204
• Total score value: -86.4486

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0629
2	F	C	-1.0461	mutated: VF2C
3	K	C	-2.1814	mutated: QK3C
4	L	C	0.0000
5	Q	C	-1.5593	mutated: VQ5C
6	E	C	0.0000
7	S	C	-0.8084
8	G	C	-0.7773
9	G	C	0.0366
10	G	C	0.9241
11	L	C	1.4404
12	V	C	-0.0388
13	Q	C	-1.3376
14	P	C	-1.4898
15	G	C	-1.4140
16	G	C	-0.9789
17	S	C	-1.2311
18	L	C	-0.9630
19	R	C	-2.1458
20	L	C	0.0000
21	S	C	-0.8223
22	C	C	0.0000
23	A	C	-0.9849
24	A	C	0.0000
25	S	C	-0.6127
26	D	C	0.0000
27	F	C	1.5639
28	T	C	0.2622
29	F	C	0.0000
30	R	C	-2.0386
31	S	C	-0.8965
32	Y	C	-1.2378
33	E	C	-1.1579
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2955
40	A	C	-0.9843
41	P	C	-1.2937
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3948
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5883
53	G	C	-1.2524
54	S	C	-1.2315
55	G	C	-1.0817
56	G	C	-0.7342
57	S	C	-0.3022
58	T	C	0.1989
59	Y	C	0.6075
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1899
75	S	C	-1.7905
76	K	C	-2.3168
77	N	C	-1.6498
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6488
81	L	C	0.0000
82	Q	C	-1.2337
83	M	C	0.0000
84	N	C	-1.3328
85	S	C	-1.2325
86	L	C	0.0000
87	R	C	-2.4725
88	A	C	-1.8896
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4216
92	A	C	0.0000
93	I	C	1.0796
94	Y	C	0.0000
95	Y	C	0.4095
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.2066
101	D	C	-3.3402
102	G	C	-2.0912
103	F	C	-1.2339
104	N	C	-2.4298
105	K	C	-3.1876
106	G	C	-1.9154
107	F	C	-1.0044
108	D	C	-1.1189
109	Y	C	-0.3207
110	W	C	0.2048
111	G	C	-0.8064
112	Q	C	-1.4418
113	G	C	-0.2263
114	T	C	0.3491
115	L	C	1.7871
116	V	C	0.0000
117	T	C	0.3367
118	N	C	0.0000	mutated: VN118C
119	S	C	-0.7752
120	S	C	-1.0605