Project name: RP5 rearranged 6-subset

Status: done

Started: 2026-07-13 07:44:30
Settings
Chain sequence(s) A: MDAMKRGLCCVLLLCGAVFVSPSQEIHARHTDLAIEYEVGVARALPQGSQGRCAPHTFKKQPLHQYARRPLFPLRAPLCICFRVADSSFLCHKAFFCGRSDYFRIEDRLHCVFQMNLVLFIDPLTRWGNPKVNSILNLFGSGLFDAAFVHCKLHNNGGMSAEEEIGPGAEPMRGPSLATYPYDVPDYA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:51)
Show buried residues

Minimal score value
-3.0481
Maximal score value
4.1216
Average score
0.0295
Total score value
5.5448

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.0631
2 D A -1.9856
3 A A -1.1331
4 M A -0.4420
5 K A -2.0623
6 R A -1.9981
7 G A -0.4685
8 L A 1.1059
9 C A 1.6798
10 C A 2.3469
11 V A 3.4389
12 L A 3.7399
13 L A 4.1216
14 L A 3.4148
15 C A 2.5856
16 G A 1.7953
17 A A 2.5674
18 V A 3.4742
19 F A 3.8219
20 V A 2.9843
21 S A 1.0796
22 P A -0.3449
23 S A -0.9935
24 Q A -1.8607
25 E A -1.7738
26 I A 0.0647
27 H A -1.2037
28 A A -1.2478
29 R A -2.5094
30 H A -2.2223
31 T A -1.4335
32 D A -1.2355
33 L A 0.8724
34 A A 1.0012
35 I A 1.5177
36 E A -0.2354
37 Y A 0.7089
38 E A -0.5827
39 V A 1.3646
40 G A 1.0076
41 V A 1.9890
42 A A 0.7596
43 R A -0.8121
44 A A 0.2402
45 L A 0.4467
46 P A -0.5127
47 Q A -1.3791
48 G A -1.3304
49 S A -1.5174
50 Q A -1.9766
51 G A -1.6531
52 R A -2.0453
53 C A -0.6391
54 A A -0.6222
55 P A -0.4820
56 H A -0.7197
57 T A -0.3263
58 F A 0.1195
59 K A -2.0954
60 K A -2.5350
61 Q A -2.2135
62 P A -1.0170
63 L A 0.6269
64 H A -0.7086
65 Q A -1.0903
66 Y A -0.2360
67 A A -0.8989
68 R A -2.4942
69 R A -2.2115
70 P A -0.7348
71 L A 0.8643
72 F A 1.3583
73 P A 0.6873
74 L A 1.0946
75 R A -0.9273
76 A A -0.4417
77 P A -0.4462
78 L A 0.3241
79 C A 0.0000
80 I A 1.4462
81 C A 1.7415
82 F A 1.5137
83 R A -0.4593
84 V A 0.8013
85 A A -0.4177
86 D A -1.7861
87 S A -0.5224
88 S A 0.5421
89 F A 2.3877
90 L A 2.1320
91 C A 1.1718
92 H A -0.5381
93 K A 0.2553
94 A A 1.5852
95 F A 3.1424
96 F A 3.0154
97 C A 1.4538
98 G A -0.5590
99 R A -2.3539
100 S A -1.4335
101 D A -1.5318
102 Y A 0.8522
103 F A 1.9272
104 R A -0.3274
105 I A 0.5424
106 E A -2.3282
107 D A -2.8694
108 R A -2.2680
109 L A 0.1053
110 H A -0.0966
111 C A 1.6054
112 V A 2.7551
113 F A 2.3714
114 Q A -0.0930
115 M A 0.2253
116 N A -0.6729
117 L A 1.1584
118 V A 2.6373
119 L A 2.9754
120 F A 3.0868
121 I A 2.3315
122 D A -0.1863
123 P A -0.0812
124 L A 0.7296
125 T A -0.3761
126 R A -1.3107
127 W A -0.0463
128 G A -1.2265
129 N A -1.8378
130 P A -1.1771
131 K A -1.8686
132 V A -0.0605
133 N A -1.0325
134 S A -0.5358
135 I A 0.8583
136 L A 0.4365
137 N A -0.2161
138 L A 1.4550
139 F A 1.4809
140 G A 0.8877
141 S A 0.5310
142 G A 0.7385
143 L A 1.8077
144 F A 2.1613
145 D A 0.1961
146 A A 0.5863
147 A A 1.3364
148 F A 2.0547
149 V A 1.1038
150 H A -0.1470
151 C A -0.1623
152 K A -0.7899
153 L A -0.2009
154 H A -1.5249
155 N A -2.3003
156 N A -2.1418
157 G A -1.3876
158 G A -1.0084
159 M A -0.2887
160 S A -0.8870
161 A A -1.5952
162 E A -2.8116
163 E A -3.0481
164 E A -2.3694
165 I A 0.0062
166 G A -0.4098
167 P A -0.5651
168 G A -0.8197
169 A A -0.8129
170 E A -2.0519
171 P A -1.2396
172 M A -0.5932
173 R A -1.9587
174 G A -1.0273
175 P A -0.4609
176 S A -0.0042
177 L A 1.5119
178 A A 1.0133
179 T A 1.0967
180 Y A 1.5001
181 P A 0.7407
182 Y A 1.1282
183 D A -0.4774
184 V A 0.8133
185 P A -0.2221
186 D A -1.0204
187 Y A 0.6197
188 A A 0.1865
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018