Project name: Midhun

Status: done

Started: 2026-06-17 04:30:29
Settings
Chain sequence(s) A: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:35)
Show buried residues

Minimal score value
-4.0515
Maximal score value
3.0562
Average score
-0.8548
Total score value
-119.6708

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8407
2 D A 0.0838
3 V A 1.8138
4 F A 1.9626
5 M A 0.8057
6 K A -0.8530
7 G A -0.6581
8 L A -0.3578
9 S A -1.8919
10 K A -2.7982
11 A A -1.6857
12 K A -1.9480
13 E A -2.1535
14 G A -0.6656
15 V A 0.9282
16 V A 0.8509
17 A A -0.5522
18 A A -0.8480
19 A A -1.1231
20 E A -2.9638
21 K A -3.2229
22 T A -2.1466
23 K A -3.3185
24 Q A -3.2108
25 G A -1.9338
26 V A -0.3219
27 A A -1.4315
28 E A -2.5943
29 A A -1.4519
30 A A -1.4590
31 G A -2.4675
32 K A -3.0327
33 T A -2.0449
34 K A -2.5502
35 E A -1.4056
36 G A -0.3021
37 V A 1.6739
38 L A 2.1494
39 Y A 2.0180
40 V A 0.6298
41 G A -0.5366
42 S A -1.1458
43 K A -2.0404
44 T A -1.7482
45 K A -2.4359
46 E A -2.3911
47 G A -1.2998
48 V A 0.5007
49 V A 0.9630
50 H A 0.0520
51 G A 0.9342
52 V A 2.5242
53 A A 0.9716
54 T A 0.4435
55 V A 0.8150
56 A A -0.7904
57 E A -2.8842
58 K A -3.3661
59 T A -2.4563
60 K A -3.7033
61 E A -4.0515
62 Q A -2.9068
63 V A -0.5868
64 T A -1.6016
65 N A -1.5481
66 V A 0.5837
67 G A 0.4582
68 G A 0.6836
69 A A 1.5849
70 V A 3.0562
71 V A 3.0367
72 T A 1.9625
73 G A 2.1551
74 V A 2.9616
75 T A 1.4555
76 A A 0.9194
77 V A 1.3303
78 A A 0.3225
79 Q A -1.1702
80 K A -1.5492
81 T A -0.6799
82 V A 0.0319
83 E A -1.7249
84 G A -0.9811
85 A A 0.0946
86 G A -0.1830
87 S A 0.3206
88 I A 1.4864
89 A A 0.9228
90 A A 1.2356
91 A A 1.2745
92 T A 1.0202
93 G A 0.9125
94 F A 1.8629
95 V A 1.1823
96 K A -1.7131
97 K A -2.7409
98 D A -3.0747
99 Q A -2.2090
100 L A -0.6707
101 G A -1.6529
102 K A -2.9237
103 N A -3.5657
104 E A -3.8963
105 E A -3.7178
106 G A -2.2185
107 A A -1.7389
108 P A -1.8909
109 Q A -2.4855
110 E A -2.4456
111 G A -0.7328
112 I A 1.3057
113 L A 0.6626
114 E A -1.3292
115 D A -0.8255
116 M A 0.4695
117 P A 0.0503
118 V A 0.1012
119 D A -2.1865
120 P A -2.3665
121 D A -3.0072
122 N A -2.6697
123 E A -2.7004
124 A A -1.2631
125 Y A -0.3340
126 E A -2.0128
127 M A -0.8401
128 P A -1.2946
129 S A -1.6610
130 E A -2.7938
131 E A -2.7542
132 G A -2.0398
133 Y A -0.6750
134 Q A -1.8112
135 D A -2.2074
136 Y A -1.0889
137 E A -2.3465
138 P A -1.8129
139 E A -2.0778
140 A A -1.1262
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018