Project name: e6fd4f9a99ee7a8

Chain sequence(s)	A: QLVESGGGLVQPGGSLRLSCAASGSVFKINVMAWYRQAPGKGRELVAGIISGGSTSYADSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCAFITTESDYDLGRRYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:10)

• Minimal score value: -2.8342
• Maximal score value: 1.7659
• Average score: -0.6372
• Total score value: -75.8316

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
3	Q	A	-0.9922
4	L	A	0.0000
5	V	A	0.4326
6	E	A	0.0000
7	S	A	-0.4178
8	G	A	-0.8732
9	G	A	0.0504
10	G	A	0.8043
11	L	A	1.4700
12	V	A	-0.0049
13	Q	A	-1.3030
14	P	A	-1.5665
15	G	A	-1.3986
16	G	A	-0.9651
17	S	A	-1.0956
18	L	A	-0.8639
19	R	A	-1.9797
20	L	A	0.0000
21	S	A	-0.4911
22	C	A	0.0000
23	A	A	-0.5347
24	A	A	-0.5585
25	S	A	-0.7438
26	G	A	-0.2913
27	S	A	0.2374
28	V	A	1.4615
29	F	A	0.7533
30	K	A	-1.3015
31	I	A	-0.2047
32	N	A	0.0467
33	V	A	0.6924
34	M	A	0.0000
35	A	A	0.0000
36	W	A	0.0000
37	Y	A	-0.1751
38	R	A	-0.7728
39	Q	A	-1.5145
40	A	A	-1.4923
41	P	A	-1.0948
42	G	A	-1.5831
43	K	A	-2.8342
44	G	A	-2.3420
45	R	A	-2.1855
46	E	A	-1.8278
47	L	A	0.1294
48	V	A	0.0000
49	A	A	0.0000
50	G	A	0.0000
51	I	A	0.0000
52	I	A	1.7659
53	S	A	0.3457
54	G	A	-0.1589
55	G	A	-0.1161
56	S	A	0.1541
57	T	A	0.2001
58	S	A	-0.1510
59	Y	A	-0.6212
60	A	A	-1.1254
61	D	A	-2.4782
62	S	A	-1.7127
63	V	A	0.0000
64	K	A	-2.6025
65	G	A	-1.7244
66	R	A	-1.5038
67	F	A	0.0000
68	T	A	-0.8593
69	I	A	0.0000
70	S	A	-0.6855
71	R	A	-1.5809
72	D	A	-2.1500
73	N	A	-2.5639
74	A	A	-1.8870
75	K	A	-2.7849
76	N	A	-2.2852
77	T	A	0.0000
78	L	A	0.0000
79	Y	A	-0.6811
80	L	A	0.0000
81	Q	A	-1.2601
82	M	A	0.0000
83	N	A	-1.4924
84	S	A	-1.2731
85	L	A	0.0000
86	R	A	-2.2961
87	P	A	-1.8579
88	E	A	-2.3116
89	D	A	0.0000
90	T	A	-0.4436
91	A	A	0.0000
92	V	A	0.6514
93	Y	A	0.0000
94	Y	A	0.1332
95	C	A	0.0000
96	A	A	0.0000
97	F	A	0.0000
98	I	A	-0.2892
99	T	A	-0.9285
100	T	A	-1.8025
101	E	A	-2.2462
102	S	A	-1.7297
103	D	A	-1.9809
104	Y	A	-0.1661
105	D	A	-1.1917
106	L	A	0.0421
107	G	A	-1.5614
108	R	A	-2.4256
109	R	A	-1.5699
110	Y	A	0.0572
111	W	A	0.4570
112	G	A	0.0000
113	Q	A	-0.8041
114	G	A	0.0025
115	T	A	0.5206
116	L	A	1.6276
117	V	A	0.0000
118	T	A	0.3623
119	V	A	0.0000
120	S	A	-0.6540
121	S	A	-0.8645