Project name: query_structure

Status: done

Started: 2026-03-16 23:36:09
Settings
Chain sequence(s) A: GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSHYAITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVFAYYSYDDIYYAYSPSSINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)
Show buried residues

Minimal score value
-2.3975
Maximal score value
2.1977
Average score
-0.3065
Total score value
-29.7337

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4098
2 S A -0.1645
3 S A 0.2129
4 V A 1.3301
5 S A 0.4509
6 S A 0.1444
7 V A 0.4728
8 P A -0.5840
9 T A -1.3700
10 K A -2.2713
11 L A -1.4822
12 E A -1.5825
13 V A 0.2704
14 V A 1.6242
15 A A 0.9283
16 A A 0.3020
17 T A -0.3865
18 P A -0.8089
19 T A -0.5311
20 S A -0.3160
21 L A 0.0000
22 L A 0.7734
23 I A 0.0000
24 S A -0.6315
25 W A 0.0000
26 D A -2.3975
27 A A -1.2559
28 S A -0.7085
29 S A -0.6403
30 S A -0.4266
31 S A -0.2556
32 V A 0.0000
33 S A 0.0739
34 H A -0.0716
35 Y A 0.0000
36 A A 0.0000
37 I A 0.0000
38 T A -0.5088
39 Y A -0.4117
40 G A 0.0000
41 E A -1.3213
42 T A -1.1890
43 G A -1.2191
44 G A -1.3437
45 N A -1.5438
46 S A -0.9076
47 P A -0.4265
48 V A 0.2617
49 Q A -1.1961
50 E A -1.7236
51 F A -0.6146
52 T A -0.1292
53 V A 0.0032
54 P A -0.3537
55 G A -0.4052
56 S A -0.4427
57 S A -0.4666
58 S A -0.6457
59 T A -0.1974
60 A A 0.0000
61 T A 0.2546
62 I A 0.0000
63 S A -0.4735
64 G A -0.6855
65 L A 0.0000
66 S A -0.8198
67 P A -0.9832
68 G A -1.0611
69 V A -0.8855
70 D A -1.7672
71 Y A 0.0000
72 T A -0.7475
73 I A 0.0000
74 T A -0.1443
75 V A 0.0000
76 F A 0.6843
77 A A 0.0000
78 Y A 1.4112
79 Y A 0.0000
80 S A 0.3906
81 Y A 0.0725
82 D A -1.6828
83 D A -1.2779
84 I A 1.3854
85 Y A 2.1617
86 Y A 2.1977
87 A A 1.6497
88 Y A 1.6740
89 S A 0.6719
90 P A 0.3950
91 S A 0.0000
92 S A -0.5649
93 I A -0.5724
94 N A -1.7029
95 Y A -1.3634
96 R A -2.2940
97 T A -1.1640
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018