Aggrescan3D: 4KPA

Project details

Project name: 4KPA

Status: error

Started: 2024-07-09 08:48:43

Settings

Chain sequence(s)	A: YFQGAMTIKEMPQPKTFGELKNLPLLNTDKPVQALMKIADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFAGDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLVQKWERLNADEHIEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENKRQFQEDIKVMNDLVDKIIADRKAQSDDLLTHMLNGKDPETGEPLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVLVDPVPSYKQVKQLKYVGMVLNEALRLWPTAPAFSLYAKEDTVLGGEYPLEKGDELMVLIPQLHRDKTIWGDDVEEFRPERFENPSAIPQHAFKPFGNGQRACIGQQFALHEATLVLGMMLKHFDFEDHTNYELDIKETLTLKPEGFVVKAKSKKIPLGGI input PDB
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	Yes

Error log

One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YE-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FD-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FE-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FR-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YK-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FK-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YD-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YR-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FD-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YE-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FE-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FR-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YK-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation FK-4A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YD-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters. One of Aggrescan3D modules (OptParser) encountered an error. 
Your mutation YR-5A was provided in wrong format. Correct formatting is <Oldres><Newres><ID><chain>. For example MW1A. Mind the capital letters.

Note Your prediction results will be deleted after 360 days.