Project name: e7fa539cbf7a003

Status: done

Started: 2026-04-01 23:43:49
Settings
Chain sequence(s) A: KIPGVKPIRLFFGQQRRDVYPSALRRLLRFIAPDLVITHMEAHVNEATGRGKGCAWVIVPSVLEAKRLLRLSGRIFLDINSNGEEVYLFAPPNCREWLSEYADYVVSSTTRASHLPYLPMVVGVPKKECIYVRELLAPYIYDPNRGDCPPYADAVSEFKGLLEDHAS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:13)
Show buried residues

Minimal score value
-3.6171
Maximal score value
1.452
Average score
-0.6857
Total score value
-114.5097

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 K A -0.9345
2 I A -0.0109
3 P A -0.5417
4 G A -0.7713
5 V A -0.7517
6 K A -1.6356
7 P A -1.2886
8 I A 0.0000
9 R A -0.9959
10 L A 0.0000
11 F A 0.6060
12 F A 0.0000
13 G A 0.0000
14 Q A 0.0322
15 Q A -0.5493
16 R A 0.0000
17 R A -2.2621
18 D A -0.9243
19 V A -0.0310
20 Y A 0.6250
21 P A -0.7156
22 S A -0.9809
23 A A 0.0000
24 L A 0.0000
25 R A -2.9619
26 R A -2.8361
27 L A 0.0000
28 L A 0.0000
29 R A -2.2143
30 F A 0.0109
31 I A 0.2502
32 A A -0.6821
33 P A -1.2665
34 D A -1.6100
35 L A 0.0000
36 V A 0.5934
37 I A 0.2847
38 T A 0.0519
39 H A -1.1862
40 M A -1.2845
41 E A -1.6417
42 A A -0.9158
43 H A -1.2984
44 V A -1.4891
45 N A -2.2576
46 E A -2.4905
47 A A -1.3131
48 T A -1.3733
49 G A -1.8905
50 R A -2.6934
51 G A 0.0000
52 K A -2.4848
53 G A -1.6913
54 C A -0.6457
55 A A 0.0000
56 W A -0.5002
57 V A 0.0000
58 I A -0.0759
59 V A 0.0000
60 P A -0.3771
61 S A 0.0000
62 V A 0.0000
63 L A 0.4571
64 E A 0.0000
65 A A 0.0000
66 K A -0.5347
67 R A -1.1511
68 L A 0.0000
69 L A 0.0000
70 R A -1.7534
71 L A -0.6035
72 S A 0.0000
73 G A -0.1524
74 R A -0.4047
75 I A 0.0000
76 F A 0.0000
77 L A 0.0000
78 D A 0.0000
79 I A -0.1160
80 N A -1.2109
81 S A -1.0988
82 N A -1.7952
83 G A -1.3891
84 E A -1.6177
85 E A -0.9981
86 V A 0.0000
87 Y A 0.0000
88 L A -0.4210
89 F A 0.0364
90 A A 0.0000
91 P A -0.6628
92 P A -1.4955
93 N A -2.2132
94 C A 0.0000
95 R A -1.8787
96 E A -2.5358
97 W A -1.2449
98 L A 0.0000
99 S A -0.8845
100 E A -1.3151
101 Y A -0.2772
102 A A 0.0000
103 D A -0.9000
104 Y A 0.4854
105 V A 0.6021
106 V A 0.5468
107 S A 0.0788
108 S A -0.0618
109 T A 0.0770
110 T A -0.1841
111 R A 0.0509
112 A A -0.1328
113 S A -0.4132
114 H A -1.2101
115 L A -0.1107
116 P A 0.0000
117 Y A 1.3789
118 L A 0.8950
119 P A 0.0000
120 M A 0.0000
121 V A 1.2574
122 V A 0.0000
123 G A 0.2666
124 V A -0.6828
125 P A -1.4319
126 K A -2.2654
127 K A -2.4205
128 E A -1.0764
129 C A 0.4334
130 I A 1.3653
131 Y A 1.4520
132 V A 0.0000
133 R A -0.7831
134 E A -0.9527
135 L A -0.1551
136 L A 0.0000
137 A A -0.2274
138 P A -0.3412
139 Y A -0.0825
140 I A 0.6320
141 Y A -0.2940
142 D A -1.6782
143 P A -1.9083
144 N A -2.9272
145 R A -3.6171
146 G A -3.0109
147 D A -2.8364
148 C A -1.4244
149 P A -0.6535
150 P A -0.3098
151 Y A 0.7211
152 A A -0.2069
153 D A -1.3312
154 A A 0.0000
155 V A -0.2372
156 S A -1.0871
157 E A -1.8887
158 F A -1.1543
159 K A -2.3339
160 G A -1.7851
161 L A 0.0000
162 L A -1.5905
163 E A -1.8487
164 D A -2.5085
165 H A -2.0112
166 A A -1.1793
167 S A -1.1184
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018