Project name: query_structure

Status: done

Started: 2026-03-16 23:29:39
Settings
Chain sequence(s) A: GSARDDVLIGDAGANVLRGLAGNDVLSGGAGDDWLWGDEGSDLLSGDAGNDVLCGGQGDDTYLFGVGYGHDSIRESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQYPD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-3.04
Maximal score value
2.185
Average score
-1.0034
Total score value
-152.5118

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.7707
2 S A -1.0051
3 A A -1.5396
4 R A -2.8374
5 D A -2.7718
6 D A -0.6792
7 V A 1.7852
8 L A 1.7821
9 I A 2.1850
10 G A 0.3117
11 D A -1.4745
12 A A -1.2288
13 G A -1.0459
14 A A -0.7620
15 N A 0.2005
16 V A 1.5161
17 L A 1.0101
18 R A -0.4648
19 G A 0.0000
20 L A -0.8906
21 A A -1.8752
22 G A -2.4942
23 N A -2.4685
24 D A 0.0000
25 V A 1.2700
26 L A 0.0000
27 S A 1.0933
28 G A 0.0000
29 G A -0.6455
30 A A -1.2127
31 G A -1.5969
32 D A -2.0105
33 D A 0.0000
34 W A 0.6990
35 L A 0.0000
36 W A -0.0733
37 G A 0.0000
38 D A -1.7168
39 E A -2.6822
40 G A -2.5823
41 S A -2.1274
42 D A 0.0000
43 L A 0.5398
44 L A 0.0000
45 S A 0.0000
46 G A 0.0000
47 D A -0.5346
48 A A -0.6556
49 G A -1.5128
50 N A -1.8648
51 D A 0.0000
52 V A -0.2227
53 L A 0.0000
54 C A -0.6211
55 G A 0.0000
56 G A -1.8033
57 Q A -2.7684
58 G A -2.6327
59 D A -2.8553
60 D A 0.0000
61 T A -0.5334
62 Y A 0.0000
63 L A -0.5640
64 F A 0.0000
65 G A 0.0000
66 V A 0.9662
67 G A 0.0254
68 Y A -0.2017
69 G A -1.1551
70 H A -1.7473
71 D A 0.0000
72 S A -0.7134
73 I A 0.0000
74 R A -1.7696
75 E A 0.0000
76 S A -1.5802
77 G A -1.9281
78 G A -2.0695
79 G A -2.3239
80 H A -2.2696
81 D A 0.0000
82 T A -1.4058
83 I A 0.0000
84 R A -2.3516
85 I A 0.0000
86 N A -1.5330
87 A A 0.0000
88 G A -1.8041
89 A A -1.7527
90 D A -2.2295
91 Q A -2.0033
92 L A 0.0000
93 W A -0.5106
94 F A 0.0000
95 A A -1.5996
96 R A -2.8276
97 Q A -2.6181
98 G A -2.3923
99 N A -3.0400
100 D A -2.5884
101 L A 0.0000
102 E A -1.5427
103 I A 0.0000
104 R A -1.4186
105 I A 0.0000
106 L A -0.3133
107 G A -0.5402
108 T A -0.8707
109 D A -1.8826
110 D A 0.0000
111 A A 0.0000
112 L A 0.0000
113 T A -1.1616
114 V A 0.0000
115 H A -2.0970
116 D A -2.8970
117 W A 0.0000
118 Y A -2.2982
119 R A -3.0366
120 D A -2.2107
121 A A -1.8626
122 D A -2.8235
123 H A -2.5939
124 R A -2.2879
125 V A 0.0000
126 E A -2.6094
127 I A -1.6371
128 I A 0.0000
129 H A -1.9099
130 A A 0.0000
131 A A -1.8012
132 N A -2.2161
133 Q A -2.0962
134 A A -1.3722
135 V A -1.3828
136 D A -2.4917
137 Q A -2.2450
138 A A -1.5239
139 G A -1.6060
140 I A 0.0000
141 E A -2.2056
142 K A -2.4074
143 L A -1.0933
144 V A 0.0000
145 E A -2.6264
146 A A -1.2643
147 M A -0.8660
148 A A -1.2314
149 Q A -1.1298
150 Y A 0.0147
151 P A -0.7388
152 D A -1.6797
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018