Project name: RP14-TPA

Status: done

Started: 2026-04-16 07:11:40
Settings
Chain sequence(s) A: MDAMKRGLCCVLLLCGAVFVSPSQEIHARHSGQNHLKEMAISVLEARACAAAGQILPQAPSGPSYATYLQPAQAQMLTPLRTAAYVNAIEKIFKVYNEAGVTFTKPLRRNNSYTSYIMAICGMPLDSFRSWIHCWKYLSVQSQLFRGSSLLFRRVIQTSKYYMRDVIAIESAWLLELAPYPYDVPDYA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:27)
Show buried residues

Minimal score value
-3.2191
Maximal score value
3.5319
Average score
-0.1389
Total score value
-26.1179

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.1946
2 D A -1.0978
3 A A -0.7640
4 M A -0.7152
5 K A -2.3288
6 R A -2.2142
7 G A -1.0833
8 L A 0.5417
9 C A 1.2899
10 C A 1.4268
11 V A 1.6606
12 L A 1.8297
13 L A 2.0856
14 L A 2.3585
15 C A 2.0915
16 G A 1.5237
17 A A 2.0616
18 V A 3.1848
19 F A 3.5319
20 V A 2.3678
21 S A 0.6284
22 P A -0.4912
23 S A -1.0080
24 Q A -1.9449
25 E A -2.2940
26 I A -1.0497
27 H A -2.0964
28 A A -2.3197
29 R A -3.0326
30 H A -2.4551
31 S A -2.1221
32 G A -2.2507
33 Q A -2.6815
34 N A -2.6832
35 H A -2.0906
36 L A -0.4572
37 K A -2.0863
38 E A -1.8574
39 M A 0.2237
40 A A 0.4937
41 I A 0.9801
42 S A 0.0496
43 V A 0.5268
44 L A 0.6065
45 E A -0.7700
46 A A -0.3757
47 R A -1.6233
48 A A -1.2089
49 C A -0.4594
50 A A -0.4084
51 A A -0.7838
52 A A -0.3609
53 G A -0.2769
54 Q A 0.0461
55 I A 1.6825
56 L A 1.1708
57 P A -0.0084
58 Q A -0.8644
59 A A -0.4817
60 P A -0.6770
61 S A -0.6254
62 G A -0.5854
63 P A -0.3388
64 S A 0.3787
65 Y A 1.4685
66 A A 0.9206
67 T A 0.8380
68 Y A 1.4536
69 L A 0.4844
70 Q A -0.9969
71 P A -0.8105
72 A A -0.6947
73 Q A -0.5410
74 A A -0.4952
75 Q A -0.9966
76 M A -0.0248
77 L A -0.2083
78 T A -0.7792
79 P A -0.4924
80 L A -0.2312
81 R A -1.2464
82 T A -0.3513
83 A A 0.2922
84 A A 0.1262
85 Y A 1.0344
86 V A 1.2108
87 N A -0.6496
88 A A -0.1508
89 I A 0.3009
90 E A -1.3920
91 K A -1.6814
92 I A 0.0136
93 F A -0.5137
94 K A -2.0404
95 V A 0.0861
96 Y A -0.0208
97 N A -1.5463
98 E A -1.8885
99 A A -0.6770
100 G A -0.6236
101 V A 0.7299
102 T A 0.1356
103 F A 1.0069
104 T A -0.3552
105 K A -1.5353
106 P A -1.2765
107 L A -0.4843
108 R A -2.8754
109 R A -3.2191
110 N A -2.9415
111 N A -2.3572
112 S A -0.8719
113 Y A 0.5633
114 T A 0.6169
115 S A 1.1869
116 Y A 2.2192
117 I A 2.6518
118 M A 2.0206
119 A A 1.3504
120 I A 1.1854
121 C A 1.1438
122 G A 0.2497
123 M A 0.3737
124 P A 0.0889
125 L A 0.5110
126 D A -1.4467
127 S A -0.8822
128 F A -0.6649
129 R A -2.0872
130 S A -0.4413
131 W A 0.4070
132 I A 0.4422
133 H A -0.6030
134 C A 0.0000
135 W A 0.2404
136 K A -0.7571
137 Y A 0.2366
138 L A 0.0000
139 S A 0.2468
140 V A 1.0308
141 Q A -0.2012
142 S A -0.1703
143 Q A 0.2762
144 L A 0.5609
145 F A 0.7880
146 R A -1.3348
147 G A -0.9886
148 S A -0.1495
149 S A 0.1711
150 L A 1.5027
151 L A 1.8506
152 F A 0.7249
153 R A -1.4778
154 R A -1.7017
155 V A -0.2832
156 I A 0.5179
157 Q A -0.2080
158 T A -0.0180
159 S A 0.1094
160 K A -0.7144
161 Y A 1.1989
162 Y A 1.2432
163 M A 0.6138
164 R A -0.6286
165 D A -0.5441
166 V A -0.1932
167 I A 0.1601
168 A A 0.0479
169 I A 0.3752
170 E A -0.8485
171 S A -0.2795
172 A A 0.0972
173 W A 0.5410
174 L A 0.8426
175 L A 1.1570
176 E A -0.3489
177 L A 0.8320
178 A A 0.8662
179 P A 0.6102
180 Y A 0.9827
181 P A 0.6793
182 Y A 0.7717
183 D A -0.6726
184 V A 0.6798
185 P A -0.3492
186 D A -1.0316
187 Y A 0.6882
188 A A 0.1581
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018