Project name: e87a433e6c5dca7

Status: done

Started: 2026-06-26 15:28:22
Settings
Chain sequence(s) A: MSHHHHHHSGMPAAAVVVNVVDVMKKNGMNYNEGLAMYKQASEQMYDTLRTSRDPDEISESIMMHAVSLVFLMEIATPENLQEFVQWVRGDGKWLHYVPDQMFWDRPTDAWWEMDPAARKAFRIIYNIMDYIDKTDPKDLEEIGAFLKETTAKLVALIEQWAANNPEQFEKMMAKMEKIAKQVKEGLQKTNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:07)
Show buried residues

Minimal score value
-4.0892
Maximal score value
0.9955
Average score
-1.2952
Total score value
-248.6863

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5615
2 S A -0.6104
3 H A -1.7277
4 H A -2.3316
5 H A -2.7135
6 H A -2.7320
7 H A -2.5388
8 H A -2.0892
9 S A -1.2877
10 G A -0.8578
11 M A -0.1622
12 P A -0.1712
13 A A -0.3036
14 A A 0.2236
15 A A 0.1693
16 V A 0.0000
17 V A 0.0000
18 V A 0.9955
19 N A -0.8904
20 V A 0.0000
21 V A 0.0000
22 D A -1.8915
23 V A -1.5720
24 M A 0.0000
25 K A -3.2209
26 K A -2.9622
27 N A -2.3865
28 G A -2.1177
29 M A 0.0000
30 N A -1.8847
31 Y A -1.1605
32 N A -1.4262
33 E A 0.0000
34 G A 0.0000
35 L A 0.0000
36 A A -0.7046
37 M A 0.0000
38 Y A 0.0000
39 K A -1.6295
40 Q A -1.7778
41 A A 0.0000
42 S A 0.0000
43 E A -2.6036
44 Q A -2.4188
45 M A 0.0000
46 Y A -1.8732
47 D A -2.9254
48 T A 0.0000
49 L A 0.0000
50 R A -3.3058
51 T A -2.0029
52 S A 0.0000
53 R A -3.7628
54 D A -3.7538
55 P A -3.0900
56 D A -3.5138
57 E A -3.1082
58 I A 0.0000
59 S A 0.0000
60 E A 0.0000
61 S A 0.0000
62 I A 0.0000
63 M A 0.0000
64 M A 0.0000
65 H A 0.0000
66 A A 0.0000
67 V A 0.0000
68 S A 0.0000
69 L A 0.0000
70 V A 0.0000
71 F A 0.0000
72 L A 0.0000
73 M A 0.0000
74 E A -2.0180
75 I A -0.8675
76 A A -1.2256
77 T A -1.1723
78 P A -1.7387
79 E A -2.6150
80 N A -2.0845
81 L A -1.7601
82 Q A -2.8214
83 E A -2.9805
84 F A 0.0000
85 V A 0.0000
86 Q A -2.6764
87 W A -2.0752
88 V A 0.0000
89 R A -2.3904
90 G A -2.1209
91 D A -2.5762
92 G A 0.0000
93 K A -2.4480
94 W A -0.8506
95 L A 0.0000
96 H A -0.5340
97 Y A 0.5515
98 V A 0.0000
99 P A 0.1924
100 D A 0.1491
101 Q A -0.4337
102 M A -0.4528
103 F A 0.8824
104 W A 0.3227
105 D A -2.0627
106 R A -2.2681
107 P A -1.4613
108 T A -2.3002
109 D A -2.6202
110 A A 0.0000
111 W A 0.0000
112 W A -0.4364
113 E A -2.4432
114 M A 0.0000
115 D A -1.5607
116 P A -1.1691
117 A A 0.0000
118 A A 0.0000
119 R A -1.6648
120 K A -2.5339
121 A A 0.0000
122 F A 0.0000
123 R A -2.1073
124 I A -1.5326
125 I A 0.0000
126 Y A -0.6637
127 N A -1.4632
128 I A 0.0000
129 M A 0.0000
130 D A -1.3240
131 Y A -1.0688
132 I A 0.0000
133 D A -2.5602
134 K A -2.4016
135 T A -2.4549
136 D A -3.0626
137 P A -3.2848
138 K A -3.5044
139 D A -4.0892
140 L A -3.1763
141 E A -3.3880
142 E A -3.6352
143 I A 0.0000
144 G A -2.1599
145 A A -1.9546
146 F A -1.4613
147 L A 0.0000
148 K A -3.1411
149 E A -2.8714
150 T A 0.0000
151 T A 0.0000
152 A A -1.6046
153 K A -2.2984
154 L A 0.0000
155 V A -0.0895
156 A A -0.6495
157 L A 0.0000
158 I A 0.0000
159 E A -0.7666
160 Q A -1.3659
161 W A 0.0000
162 A A 0.0000
163 A A -1.3059
164 N A -1.9580
165 N A -2.1471
166 P A -2.2994
167 E A -3.1566
168 Q A 0.0000
169 F A 0.0000
170 E A -3.3938
171 K A -3.2243
172 M A 0.0000
173 M A -2.0099
174 A A -2.0508
175 K A -2.2697
176 M A 0.0000
177 E A -2.2794
178 K A -2.9961
179 I A -2.1794
180 A A 0.0000
181 K A -3.4367
182 Q A -3.1912
183 V A -2.4480
184 K A -3.0741
185 E A -3.6670
186 G A -2.7162
187 L A -2.2891
188 Q A -3.3009
189 K A -3.2752
190 T A -2.1244
191 N A -2.2972
192 S A -1.6934
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018