Project name: query_structure

Status: done

Started: 2026-03-17 00:11:26
Settings
Chain sequence(s) A: MGSSHHHHHHYYLEVDNKFNKEFYNAWWEIRKLPNLNSYQKEAFKTSLKDDPSQSANLLAEAKKLNDAQAPKVD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:44)
Show buried residues

Minimal score value
-3.4682
Maximal score value
1.6091
Average score
-1.3596
Total score value
-100.6083

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7606
2 G A -0.2297
3 S A -0.6906
4 S A -1.1853
5 H A -2.0383
6 H A -2.4496
7 H A -2.6105
8 H A -2.4184
9 H A -1.9012
10 H A -0.7234
11 Y A 1.0753
12 Y A 1.6091
13 L A 1.5431
14 E A -0.3574
15 V A 0.5840
16 D A -1.7432
17 N A -2.8689
18 K A -2.5856
19 F A -0.6544
20 N A -1.7117
21 K A -3.0863
22 E A -2.6163
23 F A -1.5586
24 Y A -0.7904
25 N A -1.6294
26 A A 0.0000
27 W A -1.4251
28 W A -1.2604
29 E A -2.1932
30 I A 0.0000
31 R A -3.4682
32 K A -2.9926
33 L A 0.0000
34 P A -1.7270
35 N A -1.5209
36 L A 0.0000
37 N A -1.4279
38 S A -1.0113
39 Y A 0.0724
40 Q A -0.8532
41 K A -2.0796
42 E A -2.0770
43 A A -1.0636
44 F A 0.0000
45 K A -1.7660
46 T A -1.9712
47 S A -2.0484
48 L A 0.0000
49 K A -2.9431
50 D A -3.3444
51 D A -2.7518
52 P A -1.7995
53 S A -1.3161
54 Q A -1.9395
55 S A 0.0000
56 A A -1.1671
57 N A -1.5943
58 L A -1.2951
59 L A -1.2867
60 A A -1.5310
61 E A -2.3262
62 A A 0.0000
63 K A -2.6075
64 K A -2.9837
65 L A -1.8086
66 N A 0.0000
67 D A -3.0824
68 A A -1.8455
69 Q A -1.9132
70 A A -1.4783
71 P A -1.2429
72 K A -1.7686
73 V A 0.0113
74 D A -1.5038
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018