| Chain sequence(s) |
A: SWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGF
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:00:29)
[INFO] Auto_mut: Residue number 5 from chain A and a score of 1.959 (methionine) selected
for automated muatation (00:00:30)
[INFO] Auto_mut: Residue number 51 from chain A and a score of 1.898 (isoleucine) selected
for automated muatation (00:00:30)
[INFO] Auto_mut: Residue number 4 from chain A and a score of 1.745 (methionine) selected
for automated muatation (00:00:30)
[INFO] Auto_mut: Residue number 2 from chain A and a score of 1.561 (tryptophan) selected
for automated muatation (00:00:30)
[INFO] Auto_mut: Residue number 7 from chain A and a score of 1.520 (methionine) selected
for automated muatation (00:00:30)
[INFO] Auto_mut: Residue number 8 from chain A and a score of 1.482 (leucine) selected for
automated muatation (00:00:30)
[INFO] Auto_mut: Mutating residue number 5 from chain A (methionine) into aspartic acid (00:00:30)
[INFO] Auto_mut: Mutating residue number 5 from chain A (methionine) into glutamic acid (00:00:30)
[INFO] Auto_mut: Mutating residue number 51 from chain A (isoleucine) into glutamic acid (00:00:30)
[INFO] Auto_mut: Mutating residue number 51 from chain A (isoleucine) into lysine (00:00:47)
[INFO] Auto_mut: Mutating residue number 5 from chain A (methionine) into arginine (00:00:49)
[INFO] Auto_mut: Mutating residue number 5 from chain A (methionine) into lysine (00:00:52)
[INFO] Auto_mut: Mutating residue number 51 from chain A (isoleucine) into aspartic acid (00:01:08)
[INFO] Auto_mut: Mutating residue number 4 from chain A (methionine) into glutamic acid (00:01:12)
[INFO] Auto_mut: Mutating residue number 4 from chain A (methionine) into aspartic acid (00:01:16)
[INFO] Auto_mut: Mutating residue number 51 from chain A (isoleucine) into arginine (00:01:23)
[INFO] Auto_mut: Mutating residue number 4 from chain A (methionine) into lysine (00:01:32)
[INFO] Auto_mut: Mutating residue number 4 from chain A (methionine) into arginine (00:01:33)
[INFO] Auto_mut: Mutating residue number 2 from chain A (tryptophan) into glutamic acid (00:01:41)
[INFO] Auto_mut: Mutating residue number 2 from chain A (tryptophan) into aspartic acid (00:01:52)
[INFO] Auto_mut: Mutating residue number 7 from chain A (methionine) into glutamic acid (00:01:57)
[INFO] Auto_mut: Mutating residue number 2 from chain A (tryptophan) into lysine (00:01:58)
[INFO] Auto_mut: Mutating residue number 2 from chain A (tryptophan) into arginine (00:02:07)
[INFO] Auto_mut: Mutating residue number 7 from chain A (methionine) into lysine (00:02:14)
[INFO] Auto_mut: Mutating residue number 7 from chain A (methionine) into aspartic acid (00:02:18)
[INFO] Auto_mut: Mutating residue number 8 from chain A (leucine) into glutamic acid (00:02:25)
[INFO] Auto_mut: Mutating residue number 8 from chain A (leucine) into aspartic acid (00:02:33)
[INFO] Auto_mut: Mutating residue number 7 from chain A (methionine) into arginine (00:02:34)
[INFO] Auto_mut: Mutating residue number 8 from chain A (leucine) into lysine (00:02:38)
[INFO] Auto_mut: Mutating residue number 8 from chain A (leucine) into arginine (00:02:47)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (methionine) into glutamic
acid: Energy difference: 0.2939 kcal/mol, Difference in average score from
the base case: -0.1891 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (methionine) into lysine:
Energy difference: 0.4283 kcal/mol, Difference in average score from the
base case: -0.1831 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (methionine) into aspartic
acid: Energy difference: 0.6795 kcal/mol, Difference in average score from
the base case: -0.1868 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain A (methionine) into
arginine: Energy difference: 0.6904 kcal/mol, Difference in average score
from the base case: -0.1948 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (isoleucine) into
glutamic acid: Energy difference: 0.2701 kcal/mol, Difference in average
score from the base case: -0.2400 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (isoleucine) into lysine:
Energy difference: 0.1816 kcal/mol, Difference in average score from the
base case: -0.2340 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (isoleucine) into
aspartic acid: Energy difference: 0.3835 kcal/mol, Difference in average
score from the base case: -0.2397 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 51 from chain A (isoleucine) into
arginine: Energy difference: 0.3929 kcal/mol, Difference in average score
from the base case: -0.2517 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 4 from chain A (methionine) into glutamic
acid: Energy difference: -0.2205 kcal/mol, Difference in average score from
the base case: -0.1830 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 4 from chain A (methionine) into lysine:
Energy difference: 0.6614 kcal/mol, Difference in average score from the
base case: -0.1813 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 4 from chain A (methionine) into aspartic
acid: Energy difference: -0.1775 kcal/mol, Difference in average score from
the base case: -0.1714 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 4 from chain A (methionine) into
arginine: Energy difference: 1.2322 kcal/mol, Difference in average score
from the base case: -0.2003 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (tryptophan) into glutamic
acid: Energy difference: -0.9603 kcal/mol, Difference in average score from
the base case: -0.1825 (00:03:00)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (tryptophan) into lysine:
Energy difference: 0.2857 kcal/mol, Difference in average score from the
base case: -0.1889 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (tryptophan) into aspartic
acid: Energy difference: -1.9147 kcal/mol, Difference in average score from
the base case: -0.1696 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (tryptophan) into
arginine: Energy difference: 0.5298 kcal/mol, Difference in average score
from the base case: -0.1867 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 7 from chain A (methionine) into glutamic
acid: Energy difference: 0.2510 kcal/mol, Difference in average score from
the base case: -0.2277 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 7 from chain A (methionine) into lysine:
Energy difference: 0.3198 kcal/mol, Difference in average score from the
base case: -0.2165 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 7 from chain A (methionine) into aspartic
acid: Energy difference: 0.8421 kcal/mol, Difference in average score from
the base case: -0.1899 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 7 from chain A (methionine) into
arginine: Energy difference: 0.6213 kcal/mol, Difference in average score
from the base case: -0.2091 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 8 from chain A (leucine) into glutamic
acid: Energy difference: 0.3727 kcal/mol, Difference in average score from
the base case: -0.2443 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 8 from chain A (leucine) into lysine:
Energy difference: 0.3113 kcal/mol, Difference in average score from the
base case: -0.2436 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 8 from chain A (leucine) into aspartic
acid: Energy difference: 0.9818 kcal/mol, Difference in average score from
the base case: -0.2303 (00:03:01)
[INFO] Auto_mut: Effect of mutation residue number 8 from chain A (leucine) into arginine:
Energy difference: 0.5995 kcal/mol, Difference in average score from the
base case: -0.2527 (00:03:01)
[INFO] Main: Simulation completed successfully. (00:03:04)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | S | A | 0.5711 | |
| 2 | W | A | 1.5608 | |
| 3 | G | A | 0.9934 | |
| 4 | M | A | 1.7450 | |
| 5 | M | A | 1.9593 | |
| 6 | G | A | 1.1645 | |
| 7 | M | A | 1.5200 | |
| 8 | L | A | 1.4818 | |
| 9 | A | A | -0.0152 | |
| 10 | S | A | -0.8036 | |
| 11 | Q | A | -1.6929 | |
| 12 | Q | A | -2.1019 | |
| 13 | N | A | -2.5532 | |
| 14 | Q | A | -2.5382 | |
| 15 | S | A | -2.0849 | |
| 16 | G | A | -2.0378 | |
| 17 | P | A | -1.8865 | |
| 18 | S | A | -1.4397 | |
| 19 | G | A | -1.8311 | |
| 20 | N | A | -2.2700 | |
| 21 | N | A | -2.4181 | |
| 22 | Q | A | -2.3206 | |
| 23 | N | A | 0.0000 | |
| 24 | Q | A | -2.4142 | |
| 25 | G | A | -1.9415 | |
| 26 | N | A | 0.0000 | |
| 27 | M | A | -1.5028 | |
| 28 | Q | A | -2.1732 | |
| 29 | R | A | -2.7724 | |
| 30 | E | A | 0.0000 | |
| 31 | P | A | -1.1039 | |
| 32 | N | A | -2.1112 | |
| 33 | Q | A | -1.9622 | |
| 34 | A | A | -0.4160 | |
| 35 | F | A | 0.6659 | |
| 36 | G | A | 0.0000 | |
| 37 | S | A | 0.0000 | |
| 38 | G | A | -1.2924 | |
| 39 | N | A | -1.8075 | |
| 40 | N | A | -2.2811 | |
| 41 | S | A | -0.9871 | |
| 42 | Y | A | -0.0100 | |
| 43 | S | A | -0.4725 | |
| 44 | G | A | -0.7112 | |
| 45 | S | A | -0.7492 | |
| 46 | N | A | -1.3389 | |
| 47 | S | A | 0.0000 | |
| 48 | G | A | -0.5442 | |
| 49 | A | A | -0.0206 | |
| 50 | A | A | 0.7827 | |
| 51 | I | A | 1.8981 | |
| 52 | G | A | 0.8101 | |
| 53 | W | A | 0.5206 | |
| 54 | G | A | -0.0637 | |
| 55 | S | A | -0.1188 | |
| 56 | A | A | -0.2616 | |
| 57 | S | A | -0.7883 | |
| 58 | N | A | 0.0000 | |
| 59 | A | A | -0.1170 | |
| 60 | G | A | -0.9501 | |
| 61 | S | A | 0.0000 | |
| 62 | G | A | -0.8740 | |
| 63 | S | A | -0.2449 | |
| 64 | G | A | -0.7318 | |
| 65 | F | A | 0.9787 | |
| 66 | N | A | -0.4565 | |
| 67 | G | A | -0.3182 | |
| 68 | G | A | -0.2838 | |
| 69 | F | A | 1.3501 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| WD2A | -1.9147 | -0.1696 | View | CSV | PDB |
| WE2A | -0.9603 | -0.1825 | View | CSV | PDB |
| ME4A | -0.2205 | -0.183 | View | CSV | PDB |
| MD4A | -0.1775 | -0.1714 | View | CSV | PDB |
| IK51A | 0.1816 | -0.234 | View | CSV | PDB |
| ME7A | 0.251 | -0.2277 | View | CSV | PDB |
| IE51A | 0.2701 | -0.24 | View | CSV | PDB |
| LK8A | 0.3113 | -0.2436 | View | CSV | PDB |
| MK7A | 0.3198 | -0.2165 | View | CSV | PDB |
| LE8A | 0.3727 | -0.2443 | View | CSV | PDB |
| ME5A | 0.2939 | -0.1891 | View | CSV | PDB |
| MK5A | 0.4283 | -0.1831 | View | CSV | PDB |
ALA alanine
ARG arginine
ASN asparagine
ASP aspartic acid
CYS cysteine
GLN glutamine
GLU glutamic acid
GLY glycine
HIS histidine
ILE isoleucine
LEU leucine
LYS lysine
MET methionine
PHE phenylalanine
PRO proline
SER serine
THR threonine
TRP tryptophan
TYR tyrosine
VAL valine