Project name: lanm_B4

Chain sequence(s)	A: ASGADALKALNKDNDDSLEIAEVIHAGATTFTAINPDGDTTLESGETKGRLTEKDWARANKDGDQTLEMNEWLKILKTRFKRADANKDGKLTAAELDSKAGQGVLVMIMK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -4.0391
• Maximal score value: 0.0234
• Average score: -1.5013
• Total score value: -165.1402

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.9596
2	S	A	-1.3477
3	G	A	0.0000
4	A	A	-1.6881
5	D	A	-2.2428
6	A	A	0.0000
7	L	A	-2.3564
8	K	A	-2.8260
9	A	A	-1.3091
10	L	A	-1.5433
11	N	A	0.0000
12	K	A	-3.6482
13	D	A	-3.9700
14	N	A	-4.0391
15	D	A	-3.5815
16	D	A	-3.6116
17	S	A	0.0000
18	L	A	0.0000
19	E	A	-1.7702
20	I	A	-0.4450
21	A	A	-0.2979
22	E	A	-1.0199
23	V	A	0.0000
24	I	A	-0.4208
25	H	A	-0.6578
26	A	A	0.0000
27	G	A	0.0000
28	A	A	-0.3071
29	T	A	-0.2290
30	T	A	0.0000
31	F	A	0.0000
32	T	A	-0.4354
33	A	A	-0.2055
34	I	A	-0.6027
35	N	A	0.0000
36	P	A	-1.4409
37	D	A	-2.5092
38	G	A	-2.0406
39	D	A	-2.2322
40	T	A	-1.3750
41	T	A	-1.8319
42	L	A	0.0000
43	E	A	-2.6637
44	S	A	-2.1990
45	G	A	-1.9870
46	E	A	-1.7110
47	T	A	0.0000
48	K	A	-2.7429
49	G	A	-1.7765
50	R	A	-1.2730
51	L	A	0.0000
52	T	A	-2.3597
53	E	A	-3.4693
54	K	A	-3.2851
55	D	A	-2.4684
56	W	A	0.0000
57	A	A	-2.8072
58	R	A	-3.3129
59	A	A	-2.8834
60	N	A	0.0000
61	K	A	-3.5693
62	D	A	-3.6620
63	G	A	-3.1709
64	D	A	-3.2098
65	Q	A	-3.0592
66	T	A	-2.5340
67	L	A	0.0000
68	E	A	-2.0177
69	M	A	-1.1003
70	N	A	-1.8939
71	E	A	-2.0935
72	W	A	0.0000
73	L	A	-1.4149
74	K	A	-2.2004
75	I	A	-1.3949
76	L	A	0.0000
77	K	A	-2.1051
78	T	A	-1.9888
79	R	A	-2.0008
80	F	A	0.0000
81	K	A	-3.6076
82	R	A	-3.4811
83	A	A	0.0000
84	D	A	0.0000
85	A	A	-2.2006
86	N	A	-2.9811
87	K	A	-3.6781
88	D	A	-3.0350
89	G	A	-2.3183
90	K	A	-2.3718
91	L	A	0.0000
92	T	A	-1.2285
93	A	A	-1.2032
94	A	A	-0.6553
95	E	A	-1.5027
96	L	A	0.0000
97	D	A	-2.2975
98	S	A	-1.9340
99	K	A	-2.5492
100	A	A	-2.1015
101	G	A	0.0000
102	Q	A	-1.4582
103	G	A	-1.0189
104	V	A	0.0000
105	L	A	0.0000
106	V	A	0.0234
107	M	A	0.0000
108	I	A	0.0000
109	M	A	-0.7023
110	K	A	-1.5396