Project name: M73E

Status: done

Started: 2026-07-09 20:03:10
Settings
Chain sequence(s) A: TAEVMSHVTAHFGKTLEECREESGLSVDILDEFKHFWSDDFDVVHRELGCAIICMSNKFSLMDDDVRMHHVNEDEYIKSFPNGQVLAEKMVKLIHNCEKQFDTETDDCTRVVKVAACFKEDSRKEGIAPEVAMVEAVIEKY
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:32)
Show buried residues

Minimal score value
-4.1509
Maximal score value
0.5463
Average score
-1.1959
Total score value
-168.6194

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T A -1.1238
2 A A -1.6342
3 E A -2.2127
4 V A 0.0000
5 M A 0.0000
6 S A 0.0000
7 H A -0.6622
8 V A 0.0000
9 T A 0.0000
10 A A 0.0000
11 H A -0.3663
12 F A -0.6303
13 G A -1.2157
14 K A -2.2425
15 T A 0.0000
16 L A 0.0000
17 E A -3.5014
18 E A -3.5822
19 C A 0.0000
20 R A 0.0000
21 E A -3.5764
22 E A -3.1640
23 S A 0.0000
24 G A -1.8197
25 L A 0.0000
26 S A -0.5236
27 V A -0.1506
28 D A -1.3095
29 I A -0.5994
30 L A 0.0000
31 D A -2.1503
32 E A -2.1607
33 F A 0.0000
34 K A -1.2294
35 H A -1.7935
36 F A 0.0000
37 W A 0.0000
38 S A -2.1070
39 D A -3.5251
40 D A -3.0389
41 F A -1.8223
42 D A -1.9474
43 V A 0.0000
44 V A 0.4810
45 H A -0.8015
46 R A -1.8388
47 E A -1.5066
48 L A 0.0000
49 G A 0.0000
50 C A -0.8373
51 A A 0.0000
52 I A -0.1640
53 I A -0.2377
54 C A -0.9342
55 M A 0.0000
56 S A 0.0000
57 N A -2.0552
58 K A -2.0823
59 F A -0.9771
60 S A -1.3720
61 L A 0.0000
62 M A -2.1239
63 D A -3.2961
64 D A -3.4743
65 D A -3.2589
66 V A -2.1125
67 R A -2.1682
68 M A 0.0000
69 H A -1.2547
70 H A -0.8337
71 V A 0.5463
72 N A -0.7313
73 E A 0.0000
74 D A -1.9432
75 E A -2.3470
76 Y A -1.1885
77 I A 0.0000
78 K A -3.0023
79 S A -1.7134
80 F A -1.2611
81 P A -1.4276
82 N A -2.0708
83 G A 0.0000
84 Q A -2.4789
85 V A -0.8685
86 L A 0.0000
87 A A 0.0000
88 E A -2.9760
89 K A -2.4156
90 M A 0.0000
91 V A 0.0000
92 K A -2.7445
93 L A -1.7261
94 I A -1.1852
95 H A -2.0615
96 N A -2.3489
97 C A 0.0000
98 E A 0.0000
99 K A -3.1195
100 Q A -2.6814
101 F A -1.8651
102 D A -2.6243
103 T A -1.4144
104 E A -1.3635
105 T A -1.0054
106 D A -1.4099
107 D A -1.6422
108 C A -1.0978
109 T A -1.0724
110 R A 0.0000
111 V A 0.0000
112 V A 0.0000
113 K A -0.8314
114 V A 0.0000
115 A A 0.0000
116 A A -0.6710
117 C A -0.9976
118 F A 0.0000
119 K A 0.0000
120 E A -3.3084
121 D A -2.9758
122 S A 0.0000
123 R A -4.1509
124 K A -3.9667
125 E A -3.3799
126 G A -2.3340
127 I A 0.0000
128 A A -2.2804
129 P A 0.0000
130 E A -2.2428
131 V A -1.1184
132 A A -0.5691
133 M A -0.7652
134 V A 0.0000
135 E A -1.2910
136 A A -0.7904
137 V A 0.0000
138 I A -0.7787
139 E A -2.0875
140 K A -1.8046
141 Y A -0.0985
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018