Project name: GapC103_tagged_rank1_A3D_static_d10

Chain sequence(s)	A: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKLEHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -2.8807
• Maximal score value: 1.8817
• Average score: -0.938
• Total score value: -96.6128

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.7704
2	G	A	-0.0924
3	S	A	-0.5595
4	S	A	-1.1526
5	H	A	-1.8569
6	H	A	-2.2584
7	H	A	-2.4237
8	H	A	-2.4212
9	H	A	-2.2623
10	H	A	-1.9045
11	S	A	-1.0034
12	S	A	-0.3174
13	G	A	0.4812
14	L	A	1.8817
15	V	A	1.8657
16	P	A	-0.1318
17	R	A	-1.8530
18	G	A	-1.4723
19	S	A	-1.2305
20	H	A	-0.8777
21	M	A	0.5507
22	A	A	0.5115
23	S	A	0.4960
24	M	A	0.8495
25	T	A	-0.1446
26	G	A	-1.0424
27	G	A	-1.3559
28	Q	A	-1.9012
29	Q	A	-1.9674
30	M	A	-0.8465
31	G	A	-1.6669
32	R	A	-2.0638
33	G	A	-0.9699
34	S	A	-0.0916
35	M	A	1.3067
36	V	A	1.5472
37	V	A	1.4106
38	K	A	-0.8779
39	V	A	-0.5734
40	G	A	-1.6795
41	I	A	-0.9276
42	N	A	-1.6273
43	G	A	-0.7987
44	F	A	0.0000
45	G	A	-0.0603
46	R	A	0.1495
47	I	A	1.5580
48	G	A	0.2459
49	R	A	0.2510
50	L	A	0.4051
51	A	A	0.0929
52	F	A	-0.3734
53	R	A	-1.3154
54	R	A	-2.0816
55	I	A	-1.4975
56	Q	A	-2.4135
57	N	A	-2.3184
58	V	A	-1.4390
59	E	A	-1.6389
60	G	A	-0.3078
61	V	A	-0.1155
62	E	A	-1.5415
63	V	A	-0.9511
64	T	A	-1.2713
65	R	A	-2.4036
66	I	A	-1.0473
67	N	A	-1.7981
68	D	A	-1.0305
69	L	A	0.4884
70	T	A	-0.5152
71	D	A	-1.6528
72	P	A	-1.4758
73	N	A	-1.7791
74	M	A	-0.6901
75	L	A	-0.3099
76	A	A	-0.8713
77	H	A	-0.8997
78	L	A	-0.1650
79	L	A	0.0000
80	K	A	-1.1899
81	Y	A	-0.1672
82	D	A	0.0000
83	T	A	-0.4928
84	T	A	-0.7473
85	Q	A	-1.3724
86	G	A	-1.6108
87	R	A	-2.4147
88	F	A	-1.8206
89	D	A	-2.4943
90	G	A	-1.6900
91	T	A	-0.8895
92	V	A	-1.1884
93	E	A	-1.9861
94	V	A	-1.1889
95	K	A	-1.8469
96	L	A	-0.7861
97	E	A	-2.3100
98	H	A	-2.5415
99	H	A	-2.6812
100	H	A	-2.8807
101	H	A	-2.6439
102	H	A	-2.3570
103	H	A	-1.8588