| Chain sequence(s) |
A: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAGFAVTNDGVI
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:00)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:00)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:00)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:01:58)
[INFO] Auto_mut: Residue number 294 from chain A and a score of 2.530 (isoleucine) selected
for automated muatation (00:02:00)
[INFO] Auto_mut: Residue number 286 from chain A and a score of 2.186 (phenylalanine)
selected for automated muatation (00:02:00)
[INFO] Auto_mut: Residue number 293 from chain A and a score of 1.923 (valine) selected for
automated muatation (00:02:00)
[INFO] Auto_mut: Residue number 288 from chain A and a score of 1.564 (valine) selected for
automated muatation (00:02:00)
[INFO] Auto_mut: Residue number 1 from chain A and a score of 1.540 omitted from automated
muatation (excluded by the user). (00:02:00)
[INFO] Auto_mut: Residue number 287 from chain A and a score of 1.529 (alanine) selected for
automated muatation (00:02:00)
[INFO] Auto_mut: Residue number 83 from chain A and a score of 0.910 (tyrosine) selected for
automated muatation (00:02:00)
[INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into glutamic acid (00:02:00)
[INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into aspartic acid (00:02:00)
[INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into glutamic acid
Mutating residue number 286 from chain A (phenylalanine) into glutamic acid (00:02:00)
[INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into lysine (00:02:52)
[INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into arginine (00:02:52)
[INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into lysine (00:02:54)
[INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into aspartic acid
Mutating residue number 286 from chain A (phenylalanine) into aspartic acid (00:03:46)
[INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into glutamic acid (00:03:48)
[INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into aspartic acid (00:03:52)
[INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into arginine (00:04:39)
[INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into lysine (00:04:41)
[INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into arginine (00:04:45)
[INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into glutamic acid (00:05:35)
[INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into aspartic acid (00:05:38)
[INFO] Auto_mut: Mutating residue number 287 from chain A (alanine) into glutamic acid (00:05:41)
[INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into lysine (00:06:29)
[INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into arginine (00:06:31)
[INFO] Auto_mut: Mutating residue number 287 from chain A (alanine) into lysine (00:06:35)
[INFO] Auto_mut: Mutating residue number 287 from chain A (alanine) into aspartic acid (00:07:27)
[INFO] Auto_mut: Mutating residue number 83 from chain A (tyrosine) into glutamic acid (00:07:27)
[INFO] Auto_mut: Mutating residue number 83 from chain A (tyrosine) into aspartic acid (00:07:33)
[INFO] Auto_mut: Mutating residue number 287 from chain A (alanine) into arginine (00:08:19)
[INFO] Auto_mut: Mutating residue number 83 from chain A (tyrosine) into lysine (00:08:25)
[INFO] Auto_mut: Mutating residue number 83 from chain A (tyrosine) into arginine (00:08:27)
[INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into
glutamic acid: Energy difference: 0.0865 kcal/mol, Difference in average
score from the base case: -0.0279 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into
lysine: Energy difference: -0.6419 kcal/mol, Difference in average score
from the base case: -0.0272 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into
aspartic acid: Energy difference: 0.0956 kcal/mol, Difference in average
score from the base case: -0.0277 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into
arginine: Energy difference: -0.9580 kcal/mol, Difference in average score
from the base case: -0.0281 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into
glutamic acid: Energy difference: -0.3318 kcal/mol, Difference in average
score from the base case: -0.0421 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into
lysine: Energy difference: -0.1903 kcal/mol, Difference in average score
from the base case: -0.0417 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into
aspartic acid: Energy difference: -0.2062 kcal/mol, Difference in average
score from the base case: -0.0426 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into
arginine: Energy difference: -0.6964 kcal/mol, Difference in average score
from the base case: -0.0419 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into glutamic
acid: Energy difference: -0.6383 kcal/mol, Difference in average score from
the base case: -0.0340 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into lysine:
Energy difference: -0.3708 kcal/mol, Difference in average score from the
base case: -0.0330 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into aspartic
acid: Energy difference: -1.4489 kcal/mol, Difference in average score from
the base case: -0.0337 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into arginine:
Energy difference: -0.6011 kcal/mol, Difference in average score from the
base case: -0.0342 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into glutamic
acid: Energy difference: -0.5120 kcal/mol, Difference in average score from
the base case: -0.0420 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into lysine:
Energy difference: -0.3602 kcal/mol, Difference in average score from the
base case: -0.0408 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into aspartic
acid: Energy difference: -0.1133 kcal/mol, Difference in average score from
the base case: -0.0417 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into arginine:
Energy difference: -1.3333 kcal/mol, Difference in average score from the
base case: -0.0423 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 287 from chain A (alanine) into glutamic
acid: Energy difference: 0.1335 kcal/mol, Difference in average score from
the base case: -0.0223 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 287 from chain A (alanine) into lysine:
Energy difference: 1.4889 kcal/mol, Difference in average score from the
base case: -0.0214 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 287 from chain A (alanine) into aspartic
acid: Energy difference: -0.0360 kcal/mol, Difference in average score from
the base case: -0.0223 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 287 from chain A (alanine) into arginine:
Energy difference: -0.5440 kcal/mol, Difference in average score from the
base case: -0.0227 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 83 from chain A (tyrosine) into glutamic
acid: Energy difference: 1.4369 kcal/mol, Difference in average score from
the base case: -0.0439 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 83 from chain A (tyrosine) into lysine:
Energy difference: 0.6345 kcal/mol, Difference in average score from the
base case: -0.0324 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 83 from chain A (tyrosine) into aspartic
acid: Energy difference: 1.7026 kcal/mol, Difference in average score from
the base case: -0.0426 (00:09:42)
[INFO] Auto_mut: Effect of mutation residue number 83 from chain A (tyrosine) into arginine:
Energy difference: 0.5295 kcal/mol, Difference in average score from the
base case: -0.0378 (00:09:42)
[INFO] Main: Simulation completed successfully. (00:09:49)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | F | A | 1.5395 | |
| 2 | S | A | 0.0522 | |
| 3 | R | A | -1.2041 | |
| 4 | P | A | -0.8621 | |
| 5 | G | A | -0.8986 | |
| 6 | L | A | -0.5795 | |
| 7 | P | A | -0.2576 | |
| 8 | V | A | 0.0034 | |
| 9 | E | A | -0.3007 | |
| 10 | Y | A | 0.6128 | |
| 11 | L | A | 0.0000 | |
| 12 | Q | A | -1.8312 | |
| 13 | V | A | 0.0000 | |
| 14 | P | A | -1.6177 | |
| 15 | S | A | 0.0000 | |
| 16 | P | A | -1.0238 | |
| 17 | S | A | -0.6928 | |
| 18 | M | A | 0.0000 | |
| 19 | G | A | -1.3906 | |
| 20 | R | A | -2.0587 | |
| 21 | D | A | -2.7671 | |
| 22 | I | A | 0.0000 | |
| 23 | K | A | -1.4024 | |
| 24 | V | A | 0.0000 | |
| 25 | Q | A | 0.0000 | |
| 26 | F | A | 0.0000 | |
| 27 | Q | A | 0.0000 | |
| 28 | S | A | -0.9452 | |
| 29 | G | A | -1.1214 | |
| 30 | G | A | -1.6092 | |
| 31 | N | A | -2.2429 | |
| 32 | N | A | -2.2358 | |
| 33 | S | A | 0.0000 | |
| 34 | P | A | 0.0000 | |
| 35 | A | A | 0.0000 | |
| 36 | V | A | 0.0000 | |
| 37 | Y | A | 0.0000 | |
| 38 | L | A | 0.0000 | |
| 39 | L | A | 0.0000 | |
| 40 | D | A | 0.0000 | |
| 41 | G | A | 0.0000 | |
| 42 | L | A | -0.9906 | |
| 43 | R | A | -2.4152 | |
| 44 | A | A | 0.0000 | |
| 45 | Q | A | -2.3794 | |
| 46 | D | A | -2.9015 | |
| 47 | D | A | -1.9926 | |
| 48 | Y | A | -0.3657 | |
| 49 | N | A | 0.0000 | |
| 50 | G | A | 0.0000 | |
| 51 | W | A | 0.0000 | |
| 52 | D | A | 0.0000 | |
| 53 | I | A | 0.8590 | |
| 54 | N | A | -0.1401 | |
| 55 | T | A | 0.0000 | |
| 56 | P | A | 0.0179 | |
| 57 | A | A | 0.0000 | |
| 58 | F | A | 0.0000 | |
| 59 | E | A | -0.4837 | |
| 60 | W | A | -0.2413 | |
| 61 | Y | A | 0.0000 | |
| 62 | Y | A | -0.0873 | |
| 63 | Q | A | -1.1155 | |
| 64 | S | A | 0.0000 | |
| 65 | G | A | -0.8163 | |
| 66 | L | A | 0.0000 | |
| 67 | S | A | 0.0000 | |
| 68 | I | A | 0.0000 | |
| 69 | V | A | 0.0000 | |
| 70 | M | A | 0.0000 | |
| 71 | P | A | 0.0000 | |
| 72 | V | A | 0.0000 | |
| 73 | G | A | 0.0000 | |
| 74 | G | A | 0.0000 | |
| 75 | Q | A | -1.3098 | |
| 76 | S | A | 0.0000 | |
| 77 | S | A | 0.0000 | |
| 78 | F | A | 0.0000 | |
| 79 | Y | A | 0.0000 | |
| 80 | S | A | 0.0000 | |
| 81 | D | A | -0.5793 | |
| 82 | W | A | 0.0000 | |
| 83 | Y | A | 0.9103 | |
| 84 | S | A | 0.0546 | |
| 85 | P | A | -0.1535 | |
| 86 | A | A | 0.0000 | |
| 87 | C | A | -0.4338 | |
| 88 | G | A | -1.4061 | |
| 89 | K | A | -1.9104 | |
| 90 | A | A | -0.8344 | |
| 91 | G | A | -0.5126 | |
| 92 | C | A | 0.1103 | |
| 93 | Q | A | -0.4943 | |
| 94 | T | A | -0.4394 | |
| 95 | Y | A | 0.0000 | |
| 96 | K | A | -0.8022 | |
| 97 | W | A | 0.0000 | |
| 98 | E | A | 0.0000 | |
| 99 | T | A | -0.4216 | |
| 100 | F | A | 0.0000 | |
| 101 | L | A | 0.0000 | |
| 102 | T | A | -0.3273 | |
| 103 | S | A | -0.5044 | |
| 104 | E | A | -0.6510 | |
| 105 | L | A | 0.0000 | |
| 106 | P | A | 0.0000 | |
| 107 | Q | A | -1.4479 | |
| 108 | W | A | -0.8486 | |
| 109 | L | A | 0.0000 | |
| 110 | S | A | -1.3108 | |
| 111 | A | A | -0.8630 | |
| 112 | N | A | -1.2632 | |
| 113 | R | A | -1.6250 | |
| 114 | A | A | -1.6674 | |
| 115 | V | A | 0.0000 | |
| 116 | K | A | -1.3024 | |
| 117 | P | A | -0.9789 | |
| 118 | T | A | -0.5882 | |
| 119 | G | A | -0.4011 | |
| 120 | S | A | 0.0000 | |
| 121 | A | A | 0.0000 | |
| 122 | A | A | 0.0000 | |
| 123 | I | A | 0.0000 | |
| 124 | G | A | 0.0000 | |
| 125 | L | A | 0.0000 | |
| 126 | S | A | 0.0147 | |
| 127 | M | A | 0.0000 | |
| 128 | A | A | 0.0000 | |
| 129 | G | A | 0.0000 | |
| 130 | S | A | 0.0000 | |
| 131 | S | A | 0.0000 | |
| 132 | A | A | 0.0000 | |
| 133 | M | A | 0.0000 | |
| 134 | I | A | 0.0000 | |
| 135 | L | A | 0.0000 | |
| 136 | A | A | 0.0000 | |
| 137 | A | A | 0.0000 | |
| 138 | Y | A | -0.2325 | |
| 139 | H | A | -0.4022 | |
| 140 | P | A | -0.9172 | |
| 141 | Q | A | -1.2468 | |
| 142 | Q | A | -0.7199 | |
| 143 | F | A | 0.0000 | |
| 144 | I | A | -0.1902 | |
| 145 | Y | A | 0.0000 | |
| 146 | A | A | 0.0000 | |
| 147 | G | A | 0.0000 | |
| 148 | S | A | 0.0000 | |
| 149 | L | A | 0.0000 | |
| 150 | S | A | 0.0000 | |
| 151 | A | A | 0.0000 | |
| 152 | L | A | 0.0996 | |
| 153 | L | A | 0.0000 | |
| 154 | D | A | -0.9992 | |
| 155 | P | A | 0.0000 | |
| 156 | S | A | -1.1539 | |
| 157 | Q | A | -1.2280 | |
| 158 | G | A | -0.5235 | |
| 159 | M | A | 0.3828 | |
| 160 | G | A | 0.0000 | |
| 161 | P | A | -0.0915 | |
| 162 | S | A | 0.2368 | |
| 163 | L | A | 0.7200 | |
| 164 | I | A | 0.0000 | |
| 165 | G | A | -0.2361 | |
| 166 | L | A | 0.3908 | |
| 167 | A | A | -0.4285 | |
| 168 | M | A | 0.0000 | |
| 169 | G | A | -1.3821 | |
| 170 | D | A | -2.2650 | |
| 171 | A | A | 0.0000 | |
| 172 | G | A | 0.0000 | |
| 173 | G | A | -1.6191 | |
| 174 | Y | A | 0.0000 | |
| 175 | K | A | -1.8935 | |
| 176 | A | A | -0.8129 | |
| 177 | A | A | -0.7143 | |
| 178 | D | A | -0.5735 | |
| 179 | M | A | 0.0000 | |
| 180 | W | A | 0.0000 | |
| 181 | G | A | 0.0000 | |
| 182 | P | A | -0.6391 | |
| 183 | S | A | -0.8734 | |
| 184 | S | A | -0.7813 | |
| 185 | D | A | -0.9922 | |
| 186 | P | A | -1.0084 | |
| 187 | A | A | 0.0000 | |
| 188 | W | A | 0.0000 | |
| 189 | E | A | -1.8376 | |
| 190 | R | A | -1.2980 | |
| 191 | N | A | 0.0000 | |
| 192 | D | A | 0.0000 | |
| 193 | P | A | 0.0000 | |
| 194 | T | A | -1.3778 | |
| 195 | Q | A | -1.7886 | |
| 196 | Q | A | 0.0000 | |
| 197 | I | A | 0.0000 | |
| 198 | P | A | -1.0932 | |
| 199 | K | A | -1.4019 | |
| 200 | L | A | 0.0000 | |
| 201 | V | A | -1.2954 | |
| 202 | A | A | -0.9617 | |
| 203 | N | A | -1.4777 | |
| 204 | N | A | -1.8398 | |
| 205 | T | A | 0.0000 | |
| 206 | R | A | -0.9257 | |
| 207 | L | A | 0.0000 | |
| 208 | W | A | 0.0000 | |
| 209 | V | A | 0.0000 | |
| 210 | Y | A | 0.0000 | |
| 211 | C | A | 0.0000 | |
| 212 | G | A | 0.0000 | |
| 213 | N | A | -1.1197 | |
| 214 | G | A | 0.0000 | |
| 215 | T | A | -1.4709 | |
| 216 | P | A | -1.8386 | |
| 217 | N | A | -2.3690 | |
| 218 | E | A | -2.3564 | |
| 219 | L | A | -1.4188 | |
| 220 | G | A | -1.2435 | |
| 221 | G | A | -0.9879 | |
| 222 | A | A | -0.7956 | |
| 223 | N | A | -1.4410 | |
| 224 | I | A | -0.2968 | |
| 225 | P | A | -0.4034 | |
| 226 | A | A | -0.6817 | |
| 227 | E | A | -0.7960 | |
| 228 | F | A | 0.5047 | |
| 229 | L | A | 0.4311 | |
| 230 | E | A | 0.0000 | |
| 231 | N | A | -1.0324 | |
| 232 | F | A | 0.1041 | |
| 233 | V | A | 0.0000 | |
| 234 | R | A | -0.5525 | |
| 235 | S | A | -0.7289 | |
| 236 | S | A | 0.0000 | |
| 237 | N | A | 0.0000 | |
| 238 | L | A | -0.6064 | |
| 239 | K | A | -2.0496 | |
| 240 | F | A | 0.0000 | |
| 241 | Q | A | -1.6231 | |
| 242 | D | A | -2.6522 | |
| 243 | A | A | -1.8660 | |
| 244 | Y | A | 0.0000 | |
| 245 | N | A | -2.4507 | |
| 246 | A | A | -1.3430 | |
| 247 | A | A | -0.9926 | |
| 248 | G | A | -1.1156 | |
| 249 | G | A | -1.7789 | |
| 250 | H | A | -1.6999 | |
| 251 | N | A | -1.3402 | |
| 252 | A | A | -0.6247 | |
| 253 | V | A | 0.2137 | |
| 254 | F | A | 0.4824 | |
| 255 | N | A | 0.0446 | |
| 256 | F | A | 0.0143 | |
| 257 | P | A | -0.4823 | |
| 258 | P | A | -0.8212 | |
| 259 | N | A | -1.4580 | |
| 260 | G | A | 0.0000 | |
| 261 | T | A | 0.0000 | |
| 262 | H | A | -0.6808 | |
| 263 | S | A | -0.6893 | |
| 264 | W | A | -0.7267 | |
| 265 | E | A | -1.7113 | |
| 266 | Y | A | -0.8901 | |
| 267 | W | A | 0.0000 | |
| 268 | G | A | 0.0000 | |
| 269 | A | A | -0.6363 | |
| 270 | Q | A | -0.6157 | |
| 271 | L | A | 0.0000 | |
| 272 | N | A | -0.8850 | |
| 273 | A | A | -0.6150 | |
| 274 | M | A | 0.0000 | |
| 275 | K | A | -1.0328 | |
| 276 | G | A | -1.0909 | |
| 277 | D | A | -0.8360 | |
| 278 | L | A | 0.0000 | |
| 279 | Q | A | -0.7883 | |
| 280 | S | A | -0.6620 | |
| 281 | S | A | -0.5808 | |
| 282 | L | A | 0.0000 | |
| 283 | G | A | -0.4280 | |
| 284 | A | A | 0.0000 | |
| 285 | G | A | 0.2839 | |
| 286 | F | A | 2.1860 | |
| 287 | A | A | 1.5286 | |
| 288 | V | A | 1.5639 | |
| 289 | T | A | -0.0461 | |
| 290 | N | A | -1.5448 | |
| 291 | D | A | -1.5855 | |
| 292 | G | A | -0.2505 | |
| 293 | V | A | 1.9233 | |
| 294 | I | A | 2.5299 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VR288A | -1.3333 | -0.0423 | View | CSV | PDB |
| VD293A | -1.4489 | -0.0337 | View | CSV | PDB |
| FR286A | -0.6964 | -0.0419 | View | CSV | PDB |
| VE288A | -0.512 | -0.042 | View | CSV | PDB |
| IR294A | -0.958 | -0.0281 | View | CSV | PDB |
| VE293A | -0.6383 | -0.034 | View | CSV | PDB |
| FE286A | -0.3318 | -0.0421 | View | CSV | PDB |
| IK294A | -0.6419 | -0.0272 | View | CSV | PDB |
| AR287A | -0.544 | -0.0227 | View | CSV | PDB |
| AD287A | -0.036 | -0.0223 | View | CSV | PDB |
| YR83A | 0.5295 | -0.0378 | View | CSV | PDB |
| YK83A | 0.6345 | -0.0324 | View | CSV | PDB |