Project name: ebcc047eda269a4

Status: done

Started: 2026-06-22 16:05:17
Settings
Chain sequence(s) B: AELAALKAKLKGAKKAWDLIEEVAKQLGLDYEKIKKKTEKKKAEIDKIIA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:14)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:14)
Show buried residues

Minimal score value
-4.7545
Maximal score value
0.8096
Average score
-1.7479
Total score value
-87.3972

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -0.1988
2 E B -0.7416
3 L B 0.8096
4 A B 0.2452
5 A B -0.3215
6 L B 0.3660
7 K B -0.5593
8 A B -1.3219
9 K B -2.1540
10 L B -1.8548
11 K B -3.1281
12 G B -2.5754
13 A B -2.1121
14 K B -3.0451
15 K B -2.6762
16 A B -1.1987
17 W B -1.6627
18 D B -1.6853
19 L B -0.0854
20 I B 0.2248
21 E B -2.0353
22 E B -1.5819
23 V B 0.3410
24 A B 0.0000
25 K B -2.2807
26 Q B -1.1748
27 L B 0.3822
28 G B -0.7603
29 L B -0.4306
30 D B -2.5028
31 Y B -2.8696
32 E B -4.0632
33 K B -3.9287
34 I B -3.2513
35 K B -4.4785
36 K B -4.7545
37 K B -4.1569
38 T B 0.0000
39 E B -4.4746
40 K B -4.4094
41 K B -3.8261
42 K B -3.7064
43 A B -2.9208
44 E B -2.8503
45 I B 0.0000
46 D B -2.5348
47 K B -1.8299
48 I B 0.6315
49 I B 0.1162
50 A B -0.3714
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018