Aggrescan3D: ???

Project name: ???

Status: done

Started: 2025-02-27 12:20:13

Settings

Chain sequence(s)	A: DPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHRANFFRMVVANPILAQADIDFLLGELELLGQDL C: GDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQAQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL B: DPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHANFFRMVVANPILAQADIDFLLGELELLGQDL D: PVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL input PDB
Selected Chain(s)	A,C,B,D
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	Yes
Downloads	Download all the data

Simulation log

Toggle log display

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:11)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:29:27)
[INFO]       Auto_mut: Residue number 473 from chain B and a score of 1.892 (isoleucine) selected  
                       for automated muatation                                                     (00:30:01)
[INFO]       Auto_mut: Residue number 15 from chain D and a score of 1.475 (valine) selected for   
                       automated muatation                                                         (00:30:01)
[INFO]       Auto_mut: Residue number 473 from chain D and a score of 1.461 (isoleucine) selected  
                       for automated muatation                                                     (00:30:01)
[INFO]       Auto_mut: Residue number 473 from chain C and a score of 1.183 (isoleucine) selected  
                       for automated muatation                                                     (00:30:01)
[INFO]       Auto_mut: Residue number 15 from chain A and a score of 1.048 (valine) selected for   
                       automated muatation                                                         (00:30:01)
[INFO]       Auto_mut: Residue number 15 from chain C and a score of 0.938 (valine) selected for   
                       automated muatation                                                         (00:30:01)
[INFO]       Auto_mut: Mutating residue number 473 from chain B (isoleucine) into glutamic acid    (00:30:01)
[INFO]       Auto_mut: Mutating residue number 473 from chain B (isoleucine) into aspartic acid    (00:30:01)
[INFO]       Auto_mut: Mutating residue number 15 from chain D (valine) into glutamic acid         (00:30:01)
[INFO]       Auto_mut: Mutating residue number 15 from chain D (valine) into lysine                (00:45:29)
[INFO]       Auto_mut: Mutating residue number 473 from chain B (isoleucine) into arginine         (00:45:30)
[INFO]       Auto_mut: Mutating residue number 473 from chain B (isoleucine) into lysine           (00:46:20)
[INFO]       Auto_mut: Mutating residue number 15 from chain D (valine) into aspartic acid         (01:00:59)
[INFO]       Auto_mut: Mutating residue number 473 from chain D (isoleucine) into glutamic acid    (01:01:59)
[INFO]       Auto_mut: Mutating residue number 473 from chain D (isoleucine) into aspartic acid    (01:02:27)
[INFO]       Auto_mut: Mutating residue number 15 from chain D (valine) into arginine              (01:16:22)
[INFO]       Auto_mut: Mutating residue number 473 from chain D (isoleucine) into lysine           (01:17:40)
[INFO]       Auto_mut: Mutating residue number 473 from chain D (isoleucine) into arginine         (01:19:44)
[INFO]       Auto_mut: Mutating residue number 473 from chain C (isoleucine) into glutamic acid    (01:31:50)
[INFO]       Auto_mut: Mutating residue number 473 from chain C (isoleucine) into aspartic acid    (01:34:00)
[INFO]       Auto_mut: Mutating residue number 15 from chain A (valine) into glutamic acid         (01:36:07)
[INFO]       Auto_mut: Mutating residue number 473 from chain C (isoleucine) into lysine           (01:47:39)
[INFO]       Auto_mut: Mutating residue number 473 from chain C (isoleucine) into arginine         (01:49:34)
[INFO]       Auto_mut: Mutating residue number 15 from chain A (valine) into lysine                (01:51:46)
[INFO]       Auto_mut: Mutating residue number 15 from chain A (valine) into aspartic acid         (02:03:40)
[INFO]       Auto_mut: Mutating residue number 15 from chain C (valine) into glutamic acid         (02:05:12)
[INFO]       Auto_mut: Mutating residue number 15 from chain C (valine) into aspartic acid         (02:08:21)
[INFO]       Auto_mut: Mutating residue number 15 from chain A (valine) into arginine              (02:19:07)
[INFO]       Auto_mut: Mutating residue number 15 from chain C (valine) into lysine                (02:20:31)
[INFO]       Auto_mut: Mutating residue number 15 from chain C (valine) into arginine              (02:24:08)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain B (isoleucine) into        
                       glutamic acid: Energy difference: 0.7881 kcal/mol, Difference in average    
                       score from the base case: 0.0026                                            (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain B (isoleucine) into        
                       lysine: Energy difference: -0.2788 kcal/mol, Difference in average score    
                       from the base case: 0.0011                                                  (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain B (isoleucine) into        
                       aspartic acid: Energy difference: 0.5731 kcal/mol, Difference in average    
                       score from the base case: 0.0027                                            (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain B (isoleucine) into        
                       arginine: Energy difference: -0.1565 kcal/mol, Difference in average score  
                       from the base case: 0.0014                                                  (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain D (valine) into glutamic    
                       acid: Energy difference: -1.0130 kcal/mol, Difference in average score from 
                       the base case: 0.0020                                                       (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain D (valine) into lysine:     
                       Energy difference: -0.2111 kcal/mol, Difference in average score from the   
                       base case: 0.0022                                                           (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain D (valine) into aspartic    
                       acid: Energy difference: -1.1441 kcal/mol, Difference in average score from 
                       the base case: 0.0021                                                       (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain D (valine) into arginine:   
                       Energy difference: -0.2727 kcal/mol, Difference in average score from the   
                       base case: -0.0006                                                          (02:39:46)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain D (isoleucine) into        
                       glutamic acid: Energy difference: 0.8767 kcal/mol, Difference in average    
                       score from the base case: 0.0029                                            (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain D (isoleucine) into        
                       lysine: Energy difference: 0.7016 kcal/mol, Difference in average score     
                       from the base case: 0.0031                                                  (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain D (isoleucine) into        
                       aspartic acid: Energy difference: 0.5922 kcal/mol, Difference in average    
                       score from the base case: 0.0029                                            (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain D (isoleucine) into        
                       arginine: Energy difference: 0.4465 kcal/mol, Difference in average score   
                       from the base case: 0.0029                                                  (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain C (isoleucine) into        
                       glutamic acid: Energy difference: 1.5023 kcal/mol, Difference in average    
                       score from the base case: 0.0044                                            (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain C (isoleucine) into        
                       lysine: Energy difference: -0.0516 kcal/mol, Difference in average score    
                       from the base case: 0.0049                                                  (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain C (isoleucine) into        
                       aspartic acid: Energy difference: 1.1645 kcal/mol, Difference in average    
                       score from the base case: 0.0040                                            (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 473 from chain C (isoleucine) into        
                       arginine: Energy difference: -2.1139 kcal/mol, Difference in average score  
                       from the base case: 0.0038                                                  (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain A (valine) into glutamic    
                       acid: Energy difference: -0.8844 kcal/mol, Difference in average score from 
                       the base case: -0.0042                                                      (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain A (valine) into lysine:     
                       Energy difference: -0.4016 kcal/mol, Difference in average score from the   
                       base case: 0.0001                                                           (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain A (valine) into aspartic    
                       acid: Energy difference: -0.9922 kcal/mol, Difference in average score from 
                       the base case: -0.0009                                                      (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain A (valine) into arginine:   
                       Energy difference: -0.4779 kcal/mol, Difference in average score from the   
                       base case: 0.0022                                                           (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain C (valine) into glutamic    
                       acid: Energy difference: 0.0815 kcal/mol, Difference in average score from  
                       the base case: 0.0012                                                       (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain C (valine) into lysine:     
                       Energy difference: -0.4531 kcal/mol, Difference in average score from the   
                       base case: -0.0003                                                          (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain C (valine) into aspartic    
                       acid: Energy difference: 0.3807 kcal/mol, Difference in average score from  
                       the base case: -0.0016                                                      (02:39:47)
[INFO]       Auto_mut: Effect of mutation residue number 15 from chain C (valine) into arginine:   
                       Energy difference: -0.6426 kcal/mol, Difference in average score from the   
                       base case: -0.0021                                                          (02:39:47)
[INFO]       Main:     Simulation completed successfully.                                          (02:40:09)

Note Your prediction results will be deleted after 360 days.

Drag cursor over the plot to display residue labels.

Show buried residues

Minimal score value: -3.7134
Maximal score value: 1.8917
Average score: -0.69
Total score value: -1309.6343

Download the table (csv)

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
residue index	residue name	chain	Aggrescan3D score	mutation
13	D	A	-1.3506
14	P	A	-0.3466
15	V	A	1.0478
16	A	A	0.1356
17	V	A	-0.1485
18	E	A	-0.7734
19	A	A	-0.3698
20	L	A	0.0000
21	L	A	0.0000
22	Q	A	-1.7153
23	D	A	-2.1216
24	V	A	0.0000
25	F	A	0.0000
26	G	A	-1.5641
27	I	A	-1.6995
28	V	A	0.0000
29	V	A	0.0000
30	D	A	-2.4053
31	E	A	-1.9611
32	A	A	0.0000
33	I	A	0.0000
34	L	A	-1.0261
35	K	A	-2.0465
36	G	A	0.0000
37	T	A	-0.6894
38	S	A	-1.0465
39	A	A	-0.8280
40	S	A	-1.1257
41	E	A	-2.0285
42	K	A	-2.1099
43	V	A	0.0000
44	C	A	0.0000
45	E	A	-1.6685
46	W	A	-1.4318
47	K	A	-1.8904
48	E	A	-2.3995
49	P	A	-2.4048
50	E	A	-3.3577
51	E	A	-3.2540
52	L	A	0.0000
53	K	A	-3.0671
54	Q	A	-2.9221
55	L	A	-1.3547
56	L	A	0.0000
57	D	A	-2.5538
58	L	A	0.0000
59	E	A	-2.9360
60	L	A	0.0000
61	Q	A	-1.6970
62	S	A	-1.4290
63	Q	A	-1.9013
64	G	A	-1.5831
65	E	A	-1.5845
66	S	A	-1.7091
67	R	A	-2.8123
68	E	A	-3.2728
69	Q	A	-2.8216
70	I	A	0.0000
71	L	A	-2.6252
72	E	A	-3.2937
73	R	A	-2.4089
74	C	A	0.0000
75	R	A	-2.7069
76	T	A	-1.4777
77	V	A	0.0000
78	I	A	0.0000
79	H	A	-1.3850
80	Y	A	-0.5821
81	S	A	0.0000
82	V	A	0.0000
83	K	A	-0.8304
84	T	A	0.0000
85	G	A	-0.0922
86	H	A	0.0000
87	P	A	0.0000
88	R	A	-0.3957
89	F	A	0.0000
90	F	A	0.0000
91	N	A	0.0000
92	Q	A	-0.2388
93	L	A	0.0000
94	F	A	0.0000
95	S	A	0.0000
96	G	A	0.0000
97	L	A	0.1401
98	D	A	0.0000
99	P	A	-0.1529
100	H	A	-0.1265
101	A	A	0.0000
102	L	A	0.0000
103	A	A	0.0000
104	G	A	0.0000
105	R	A	0.0000
106	I	A	0.0000
107	I	A	0.0000
108	T	A	0.0000
109	E	A	0.0000
110	S	A	0.0000
111	L	A	0.0000
112	N	A	0.0000
113	T	A	0.0000
114	S	A	0.0000
115	Q	A	0.0000
116	Y	A	0.0198
117	T	A	0.2678
118	Y	A	0.0000
119	E	A	0.0000
120	I	A	0.0000
121	A	A	0.0000
122	P	A	0.0000
123	V	A	0.0000
124	F	A	0.0000
125	V	A	0.0000
126	L	A	0.0000
127	M	A	0.0000
128	E	A	0.0000
129	E	A	-1.5414
130	E	A	-1.8751
131	V	A	0.0000
132	L	A	0.0000
133	K	A	-2.2364
134	K	A	-1.6575
135	L	A	0.0000
136	R	A	-1.3329
137	A	A	-1.0125
138	L	A	-0.4801
139	V	A	0.0000
140	G	A	-1.2735
141	W	A	0.0000
142	N	A	-1.8825
143	S	A	-1.5581
144	G	A	-1.5889
145	D	A	-1.2752
146	G	A	0.0000
147	V	A	0.0000
148	F	A	0.0000
149	C	A	0.0000
150	P	A	0.0000
151	G	A	0.0000
152	G	A	-0.0566
153	S	A	0.0000
154	I	A	0.0000
155	S	A	0.0000
156	N	A	0.0000
157	M	A	0.0000
158	Y	A	0.0000
159	A	A	0.0000
160	M	A	0.0000
161	N	A	0.0000
162	L	A	0.0000
163	A	A	0.0000
164	R	A	0.0000
165	F	A	0.0000
166	Q	A	-1.3976
167	R	A	-1.1673
168	Y	A	-0.8726
169	P	A	-1.7760
170	D	A	-2.5556
171	C	A	0.0000
172	K	A	-2.0425
173	Q	A	-3.0061
174	R	A	-3.5023
175	G	A	0.0000
176	L	A	0.0000
177	R	A	-1.7835
178	A	A	-1.7795
179	L	A	0.0000
180	P	A	-0.6924
181	P	A	-0.9885
182	L	A	0.0000
183	A	A	0.0000
184	L	A	0.0000
185	F	A	0.0000
186	T	A	0.0000
187	S	A	0.0000
188	K	A	-1.9804
189	E	A	-1.1808
190	C	A	-0.2218
191	H	A	0.1166
192	Y	A	0.6722
193	S	A	0.0000
194	I	A	0.0000
195	T	A	-0.3163
196	K	A	-0.1960
197	G	A	0.0000
198	A	A	0.0000
199	A	A	-0.8627
200	F	A	0.0000
201	L	A	0.0000
202	G	A	0.0000
203	L	A	0.0000
204	G	A	0.0000
205	T	A	-1.6343
206	D	A	-2.0008
207	S	A	-1.1428
208	V	A	0.0000
209	R	A	-0.8410
210	V	A	-0.1398
211	V	A	0.0000
212	K	A	-2.3920
213	A	A	-2.0359
214	D	A	-2.4819
215	E	A	-2.9699
216	R	A	-2.9626
217	G	A	0.0000
218	R	A	-1.7236
219	M	A	0.0000
220	I	A	-0.9947
221	P	A	-1.6116
222	E	A	-2.4703
223	D	A	0.0000
224	L	A	0.0000
225	E	A	-1.5013
226	R	A	-1.6183
227	Q	A	-0.8193
228	I	A	0.0000
229	I	A	0.8253
230	L	A	0.3804
231	A	A	0.0000
232	E	A	-1.4804
233	A	A	-0.9317
234	E	A	-2.0243
235	G	A	-1.7687
236	S	A	-0.9313
237	V	A	-0.3644
238	P	A	0.0000
239	F	A	0.0000
240	L	A	0.0000
241	V	A	0.0000
242	S	A	0.0000
243	A	A	0.0000
244	T	A	0.0000
245	S	A	0.0000
246	G	A	0.0000
247	T	A	0.0000
248	T	A	-0.0072
249	V	A	-0.0448
250	L	A	0.0000
251	G	A	0.0000
252	A	A	0.0000
253	F	A	0.0000
254	D	A	0.0000
255	P	A	-0.5183
256	L	A	0.0000
257	D	A	-1.9519
258	A	A	-1.3625
259	I	A	0.0000
260	A	A	0.0000
261	D	A	-2.4356
262	V	A	0.0000
263	C	A	0.0000
264	Q	A	-2.7756
265	R	A	-2.9998
266	H	A	-1.7437
267	G	A	-1.6626
268	L	A	0.0000
269	W	A	0.0000
270	F	A	0.0000
271	H	A	0.0000
272	V	A	0.0000
273	D	A	0.0000
274	A	A	0.0000
275	A	A	-0.0684
276	W	A	0.0000
277	G	A	0.0000
278	G	A	0.0000
279	S	A	0.0000
280	V	A	0.0000
281	L	A	0.0000
282	L	A	0.0000
283	S	A	0.0000
284	R	A	-2.3810
285	T	A	-1.5046
286	H	A	-1.4817
287	R	A	-1.9750
288	H	A	-1.9600
289	L	A	-0.8305
290	L	A	0.0000
291	D	A	-2.0444
292	G	A	0.0000
293	I	A	0.0000
294	Q	A	-1.6017
295	R	A	-1.8038
296	A	A	0.0000
297	D	A	-1.0360
298	S	A	0.0000
299	V	A	0.0000
300	A	A	0.0000
301	W	A	0.0000
302	N	A	0.0000
303	P	A	0.0000
304	H	A	0.0000
305	K	A	-0.2417
306	L	A	0.0000
307	L	A	0.0000
308	A	A	0.0000
309	A	A	0.0000
310	G	A	0.0000
311	L	A	0.0000
312	Q	A	0.0000
313	C	A	0.0000
314	S	A	0.0000
315	A	A	0.0000
316	L	A	0.0000
317	L	A	0.0000
318	L	A	0.0000
319	R	A	-1.8823
320	D	A	-1.3495
321	T	A	-1.0493
322	S	A	-1.2712
323	N	A	-2.0461
324	L	A	0.0000
325	L	A	0.0000
326	K	A	-1.8547
327	R	A	-2.3090
328	C	A	0.0000
329	H	A	0.0000
330	G	A	0.0000
331	S	A	-1.0977
332	Q	A	-1.4878
336	L	A	0.9174
337	F	A	-0.6805
338	Q	A	-1.8661
339	Q	A	-2.0986
340	D	A	-2.5042
341	K	A	-1.3965
342	F	A	-0.5653
343	Y	A	0.0000
344	D	A	-1.3728
345	V	A	0.3450
346	A	A	0.0812
347	L	A	0.0353
348	D	A	-0.0614
349	T	A	0.0000
350	G	A	-0.4312
351	D	A	-1.6535
352	K	A	-1.2040
353	V	A	0.0000
354	V	A	0.0000
355	Q	A	0.0000
356	C	A	-0.0411
357	G	A	-0.0522
358	R	A	0.0000
359	R	A	0.0000
360	V	A	0.0000
361	D	A	0.0000
362	C	A	0.0000
363	L	A	0.0000
364	K	A	0.0000
365	L	A	0.0000
366	W	A	0.0000
367	L	A	0.0000
368	M	A	0.0000
369	W	A	0.0000
370	K	A	0.0000
371	A	A	-0.9800
372	Q	A	-1.2434
373	G	A	0.0000
374	G	A	-1.2308
375	Q	A	-1.5989
376	G	A	-1.5168
377	L	A	0.0000
378	E	A	0.0000
379	R	A	-2.5322
380	R	A	-1.6167
381	I	A	0.0000
382	D	A	-1.8198
383	Q	A	-1.8135
384	A	A	0.0000
385	F	A	0.0000
386	A	A	-0.9318
387	L	A	0.0000
388	T	A	0.0000
389	R	A	-2.1747
390	Y	A	-1.3295
391	L	A	0.0000
392	V	A	0.0000
393	E	A	-2.9475
394	E	A	-2.6825
395	I	A	0.0000
396	K	A	-3.6634
397	K	A	-3.6905
398	R	A	-3.1223
399	E	A	-3.0342
400	G	A	0.0000
401	F	A	0.0000
402	E	A	-1.5045
403	L	A	-0.6766
404	V	A	-0.3825
405	M	A	-1.1929
406	E	A	-1.9677
407	P	A	-1.4303
408	E	A	-1.1605
409	F	A	0.0000
410	V	A	0.0000
411	N	A	0.0000
412	V	A	0.0000
413	C	A	0.0000
414	F	A	0.0000
415	W	A	0.0000
416	F	A	0.0000
417	V	A	0.0000
418	P	A	0.0000
419	P	A	-1.4134
420	S	A	-1.0536
421	L	A	0.0000
422	R	A	-1.7213
423	G	A	-2.0690
424	K	A	-3.0838
425	K	A	-3.3475
426	E	A	-3.2316
427	S	A	-2.3702
428	P	A	-1.9511
429	D	A	-2.5080
430	Y	A	0.0000
431	S	A	-2.3909
432	Q	A	-2.5106
433	R	A	-2.0493
434	L	A	0.0000
435	S	A	-1.5727
436	Q	A	-1.6496
437	V	A	0.0000
438	A	A	0.0000
439	P	A	0.0000
440	V	A	-0.1566
441	L	A	0.0000
442	K	A	0.0000
443	E	A	-1.1852
444	R	A	-1.4012
445	M	A	0.0000
446	V	A	0.0000
447	K	A	-2.5684
448	K	A	-2.1674
449	G	A	0.0000
450	T	A	-1.1552
451	M	A	0.0000
452	M	A	0.0000
453	I	A	0.0000
454	G	A	-0.0934
455	Y	A	-0.2034
456	Q	A	-0.8913
457	P	A	-1.3685
458	H	A	-1.5026
461	R	A	-2.3173
462	A	A	0.0000
463	N	A	-1.2722
464	F	A	0.0000
465	F	A	0.0000
466	R	A	0.0000
467	M	A	0.0000
468	V	A	0.0000
469	V	A	0.0000
470	A	A	0.0000
471	N	A	0.0000
472	P	A	-0.1570
473	I	A	0.3191
474	L	A	0.0000
475	A	A	-0.4072
476	Q	A	-0.9516
477	A	A	-0.5091
478	D	A	0.0000
479	I	A	0.0000
480	D	A	-0.7419
481	F	A	-0.1171
482	L	A	0.0000
483	L	A	0.0000
484	G	A	-0.2522
485	E	A	0.0000
486	L	A	0.0000
487	E	A	-1.0400
488	L	A	-0.0978
489	L	A	-0.4297
490	G	A	0.0000
491	Q	A	-1.9008
492	D	A	-2.1607
493	L	A	-1.0840
13	D	B	-1.2076
14	P	B	-0.4694
15	V	B	0.9116
16	A	B	-0.0859
17	V	B	-0.3933
18	E	B	-1.1517
19	A	B	-0.5486
20	L	B	0.0000
21	L	B	0.0000
22	Q	B	-1.5989
23	D	B	-2.0394
24	V	B	0.0000
25	F	B	0.0000
26	G	B	-1.4589
27	I	B	-1.4027
28	V	B	0.0000
29	V	B	0.0000
30	D	B	-2.4269
31	E	B	-1.8577
32	A	B	0.0000
33	I	B	0.0000
34	L	B	-1.0661
35	K	B	-2.3607
36	G	B	0.0000
37	T	B	-0.5603
38	S	B	-1.0305
39	A	B	-0.8540
40	S	B	-1.0939
41	E	B	-1.8700
42	K	B	-2.5792
43	V	B	0.0000
44	C	B	0.0000
45	E	B	-1.6993
46	W	B	-1.6674
47	K	B	-1.7481
48	E	B	-2.2124
49	P	B	-2.2961
50	E	B	-3.2646
51	E	B	-3.0601
52	L	B	0.0000
53	K	B	-3.0876
54	Q	B	-2.6221
55	L	B	-1.1616
56	L	B	0.0000
57	D	B	-2.3877
58	L	B	0.0000
59	E	B	-2.7167
60	L	B	0.0000
61	Q	B	-1.7975
62	S	B	-1.3962
63	Q	B	-1.8763
64	G	B	-1.6179
65	E	B	-1.6461
66	S	B	-1.7115
67	R	B	-2.7042
68	E	B	-3.2669
69	Q	B	-2.8732
70	I	B	0.0000
71	L	B	-2.4187
72	E	B	-3.0820
73	R	B	-2.0000
74	C	B	0.0000
75	R	B	-2.0078
76	T	B	-1.0400
77	V	B	0.0000
78	I	B	0.0000
79	H	B	-1.2294
80	Y	B	-0.4028
81	S	B	0.0000
82	V	B	0.0000
83	K	B	-0.8828
84	T	B	0.0000
85	G	B	0.0000
86	H	B	0.0000
87	P	B	0.0000
88	R	B	-0.3380
89	F	B	0.0000
90	F	B	0.0000
91	N	B	0.0000
92	Q	B	-0.2536
93	L	B	0.0000
94	F	B	0.0000
95	S	B	0.0000
96	G	B	0.0000
97	L	B	0.3691
98	D	B	0.0000
99	P	B	-0.1365
100	H	B	-0.2195
101	A	B	0.0000
102	L	B	0.0000
103	A	B	0.0000
104	G	B	0.0000
105	R	B	0.0000
106	I	B	0.0000
107	I	B	0.0000
108	T	B	0.0000
109	E	B	0.0000
110	S	B	0.0000
111	L	B	0.0000
112	N	B	0.0000
113	T	B	0.0000
114	S	B	0.0000
115	Q	B	0.0000
116	Y	B	0.0315
117	T	B	0.0000
118	Y	B	0.0000
119	E	B	-0.0795
120	I	B	0.0000
121	A	B	0.0000
122	P	B	0.0000
123	V	B	0.0000
124	F	B	0.0000
125	V	B	0.0000
126	L	B	0.0000
127	M	B	0.0000
128	E	B	0.0000
129	E	B	-1.2637
130	E	B	0.0000
131	V	B	0.0000
132	L	B	0.0000
133	K	B	-2.2516
134	K	B	-1.7165
135	L	B	0.0000
136	R	B	-1.3932
137	A	B	-1.0459
138	L	B	-0.4417
139	V	B	0.0000
140	G	B	-1.2787
141	W	B	0.0000
142	N	B	-1.9188
143	S	B	-1.6039
144	G	B	-1.5888
145	D	B	-1.2560
146	G	B	0.0000
147	V	B	0.0000
148	F	B	0.0000
149	C	B	0.0000
150	P	B	0.0000
151	G	B	-0.0895
152	G	B	-0.0974
153	S	B	0.0000
154	I	B	0.0000
155	S	B	0.0000
156	N	B	0.0000
157	M	B	0.0000
158	Y	B	0.0000
159	A	B	0.0000
160	M	B	0.0000
161	N	B	0.0000
162	L	B	0.0000
163	A	B	0.0000
164	R	B	0.0000
165	F	B	0.0000
166	Q	B	-1.6266
167	R	B	-1.5720
168	Y	B	-1.1266
169	P	B	-1.8788
170	D	B	-2.7397
171	C	B	0.0000
172	K	B	0.0000
173	Q	B	-2.7474
174	R	B	-3.5931
175	G	B	0.0000
176	L	B	0.0000
177	R	B	-2.8174
178	A	B	-1.9764
179	L	B	0.0000
180	P	B	-0.6168
181	P	B	-1.0195
182	L	B	0.0000
183	A	B	0.0000
184	L	B	0.0000
185	F	B	0.0000
186	T	B	0.0000
187	S	B	0.0000
188	K	B	-1.9621
189	E	B	-1.2963
190	C	B	-0.4092
191	H	B	-0.1626
192	Y	B	0.1127
193	S	B	0.0000
194	I	B	0.0000
195	T	B	0.0118
196	K	B	0.0000
197	G	B	0.0000
198	A	B	0.0000
199	A	B	-0.3868
200	F	B	0.0000
201	L	B	0.0000
202	G	B	0.0000
203	L	B	0.0000
204	G	B	0.0000
205	T	B	-0.9082
206	D	B	-1.1875
207	S	B	0.0000
208	V	B	0.0000
209	R	B	-0.5181
210	V	B	-0.1845
211	V	B	0.0000
212	K	B	-1.9560
213	A	B	-1.9441
214	D	B	-2.5711
215	E	B	-2.7778
216	R	B	-2.4061
217	G	B	0.0000
218	R	B	-1.7561
219	M	B	0.0000
220	I	B	-1.0236
221	P	B	-1.4937
222	E	B	-2.3675
223	D	B	-1.5919
224	L	B	0.0000
225	E	B	-1.2956
226	R	B	-1.4212
227	Q	B	-0.7262
228	I	B	0.0000
229	I	B	0.7281
230	L	B	0.1800
231	A	B	0.0000
232	E	B	-1.5279
233	A	B	-1.0290
234	E	B	-2.0687
235	G	B	-1.7425
236	S	B	-0.8935
237	V	B	-0.2287
238	P	B	0.0000
239	F	B	0.0000
240	L	B	0.0000
241	V	B	0.0000
242	S	B	0.0000
243	A	B	0.0000
244	T	B	0.0000
245	S	B	0.0000
246	G	B	0.0000
247	T	B	0.0000
248	T	B	-0.0298
249	V	B	-0.0997
250	L	B	0.0000
251	G	B	0.0000
252	A	B	0.0000
253	F	B	0.0000
254	D	B	0.0000
255	P	B	-0.6114
256	L	B	0.0000
257	D	B	-1.9163
258	A	B	-1.2247
259	I	B	0.0000
260	A	B	0.0000
261	D	B	-2.4042
262	V	B	0.0000
263	C	B	0.0000
264	Q	B	-2.7259
265	R	B	-2.9690
266	H	B	-1.6686
267	G	B	-1.5408
268	L	B	0.0000
269	W	B	-0.4969
270	F	B	0.0000
271	H	B	0.0000
272	V	B	0.0000
273	D	B	0.0000
274	A	B	0.0000
275	A	B	-0.0713
276	W	B	0.0000
277	G	B	0.0000
278	G	B	0.0000
279	S	B	0.0000
280	V	B	0.0000
281	L	B	0.0000
282	L	B	0.0000
283	S	B	0.0000
284	R	B	-2.3271
285	T	B	-1.4581
286	H	B	-1.3663
287	R	B	-1.8157
288	H	B	-1.9743
289	L	B	-0.8958
290	L	B	0.0000
291	D	B	-2.1911
292	G	B	0.0000
293	I	B	0.0000
294	Q	B	-1.5695
295	R	B	-1.7560
296	A	B	0.0000
297	D	B	-0.9027
298	S	B	0.0000
299	V	B	0.0000
300	A	B	0.0000
301	W	B	0.0000
302	N	B	0.0000
303	P	B	0.0000
304	H	B	0.0000
305	K	B	-0.2533
306	L	B	0.0000
307	L	B	0.0000
308	A	B	0.0000
309	A	B	0.0000
310	G	B	0.0000
311	L	B	0.0000
312	Q	B	0.0000
313	C	B	0.0000
314	S	B	0.0000
315	A	B	0.0000
316	L	B	0.0000
317	L	B	0.0000
318	L	B	0.0000
319	R	B	-1.8376
320	D	B	-1.2794
321	T	B	-1.0145
322	S	B	-1.2280
323	N	B	-1.9959
324	L	B	0.0000
325	L	B	0.0000
326	K	B	-1.9285
327	R	B	-2.1539
328	C	B	0.0000
329	H	B	0.0000
330	G	B	0.0000
331	S	B	-1.0730
332	Q	B	-1.5239
341	K	B	-1.5038
342	F	B	-0.7951
343	Y	B	0.0000
344	D	B	-1.2541
345	V	B	0.5991
346	A	B	0.2472
347	L	B	0.1632
348	D	B	0.0194
349	T	B	0.0000
350	G	B	-0.6332
351	D	B	-1.7498
352	K	B	-1.2401
353	V	B	0.0000
354	V	B	0.0000
355	Q	B	0.0000
356	C	B	-0.0159
357	G	B	-0.1014
358	R	B	0.0000
359	R	B	0.0000
360	V	B	0.0000
361	D	B	0.0000
362	C	B	0.0000
363	L	B	0.0000
364	K	B	0.0000
365	L	B	0.0000
366	W	B	0.0000
367	L	B	0.0000
368	M	B	0.0000
369	W	B	0.0000
370	K	B	0.0000
371	A	B	-1.0653
372	Q	B	-1.3515
373	G	B	0.0000
374	G	B	-1.3938
375	Q	B	-1.6759
376	G	B	-1.4660
377	L	B	0.0000
378	E	B	0.0000
379	R	B	-2.5712
380	R	B	-1.4524
381	I	B	0.0000
382	D	B	-1.9017
383	Q	B	-1.5176
384	A	B	0.0000
385	F	B	-0.9315
386	A	B	-1.0141
387	L	B	0.0000
388	T	B	0.0000
389	R	B	-2.1394
390	Y	B	-1.5171
391	L	B	0.0000
392	V	B	0.0000
393	E	B	-3.0915
394	E	B	0.0000
395	I	B	0.0000
396	K	B	-3.5759
397	K	B	-3.6115
398	R	B	-2.9868
399	E	B	-2.9646
400	G	B	0.0000
401	F	B	0.0000
402	E	B	-1.1530
403	L	B	-0.6122
404	V	B	0.1307
405	M	B	-0.9374
406	E	B	-1.7644
407	P	B	-1.2866
408	E	B	-1.0388
409	F	B	0.0000
410	V	B	0.0000
411	N	B	0.0000
412	V	B	0.0000
413	C	B	0.0000
414	F	B	0.0000
415	W	B	0.1077
416	F	B	0.0000
417	V	B	0.0000
418	P	B	0.0000
419	P	B	-1.4645
420	S	B	-1.1150
421	L	B	0.0000
422	R	B	-1.7946
423	G	B	-2.0814
424	K	B	-3.0597
425	K	B	-3.4262
426	E	B	-3.4451
427	S	B	-2.3429
428	P	B	-2.1193
429	D	B	-2.3439
430	Y	B	-2.3476
431	S	B	-2.0450
432	Q	B	-2.5407
433	R	B	-1.8440
434	L	B	0.0000
435	S	B	-1.4367
436	Q	B	-1.5963
437	V	B	0.0000
438	A	B	0.0000
439	P	B	0.0000
440	V	B	-0.2441
441	L	B	0.0000
442	K	B	0.0000
443	E	B	-1.6324
444	R	B	-1.6934
445	M	B	0.0000
446	V	B	0.0000
447	K	B	-2.8745
448	K	B	-2.7208
449	G	B	0.0000
450	T	B	-1.3857
451	M	B	0.0000
452	M	B	0.0000
453	I	B	0.0000
454	G	B	-0.0966
455	Y	B	-0.1413
456	Q	B	-0.7087
457	P	B	-1.2037
458	H	B	-1.3986
462	A	B	-1.0668
463	N	B	-0.8444
464	F	B	0.0000
465	F	B	0.0000
466	R	B	-0.1112
467	M	B	0.0000
468	V	B	0.0000
469	V	B	0.0000
470	A	B	0.0000
471	N	B	0.0000
472	P	B	0.5401
473	I	B	1.8917
474	L	B	0.0000
475	A	B	-0.2153
476	Q	B	-1.2592
477	A	B	-0.7091
478	D	B	0.0000
479	I	B	0.0000
480	D	B	-0.9822
481	F	B	-0.2760
482	L	B	0.0000
483	L	B	0.0000
484	G	B	-0.2551
485	E	B	0.0000
486	L	B	0.0000
487	E	B	-1.0472
488	L	B	0.1757
489	L	B	0.0000
490	G	B	0.0000
491	Q	B	-1.8808
492	D	B	-2.1720
493	L	B	-1.0731
12	G	C	-1.1714
13	D	C	-1.5985
14	P	C	-0.5698
15	V	C	0.9383
16	A	C	-0.1496
17	V	C	-0.4854
18	E	C	-0.9785
19	A	C	-0.5210
20	L	C	0.0000
21	L	C	0.0000
22	Q	C	-1.9477
23	D	C	-2.3702
24	V	C	0.0000
25	F	C	0.0000
26	G	C	-1.6266
27	I	C	0.0000
28	V	C	0.0000
29	V	C	0.0000
30	D	C	-2.1689
31	E	C	-1.8185
32	A	C	0.0000
33	I	C	0.0000
34	L	C	-0.9311
35	K	C	-2.2441
36	G	C	0.0000
37	T	C	-0.6043
38	S	C	-1.0933
39	A	C	-0.9750
40	S	C	-1.2942
41	E	C	-2.2841
42	K	C	-2.7045
43	V	C	0.0000
44	C	C	0.0000
45	E	C	-1.5280
46	W	C	-1.5900
47	K	C	-2.1511
48	E	C	-3.0256
49	P	C	-2.7393
50	E	C	-3.6305
51	E	C	-3.6499
52	L	C	0.0000
53	K	C	-3.3078
54	Q	C	-2.8278
55	L	C	-1.3535
56	L	C	0.0000
57	D	C	-2.6990
58	L	C	0.0000
59	E	C	-2.7681
60	L	C	0.0000
61	Q	C	-1.6063
62	S	C	-1.3096
63	Q	C	-1.8342
64	G	C	-1.5933
65	E	C	-1.6374
66	S	C	-1.9643
67	R	C	-2.8657
68	E	C	-3.3713
69	Q	C	-2.9935
70	I	C	0.0000
71	L	C	-2.6433
72	E	C	-3.2972
73	R	C	-2.4187
74	C	C	0.0000
75	R	C	-2.2168
76	T	C	-1.2484
77	V	C	0.0000
78	I	C	0.0000
79	H	C	-1.3905
80	Y	C	-0.4799
81	S	C	0.0000
82	V	C	0.0000
83	K	C	-0.8561
84	T	C	0.0000
85	G	C	0.0000
86	H	C	0.0000
87	P	C	0.0000
88	R	C	-0.3483
89	F	C	0.0000
90	F	C	0.0000
91	N	C	0.0000
92	Q	C	-0.2733
93	L	C	0.0000
94	F	C	0.0000
95	S	C	0.0000
96	G	C	0.0000
97	L	C	0.3142
98	D	C	0.0000
99	P	C	-0.0394
100	H	C	-0.2113
101	A	C	0.0000
102	L	C	0.0000
103	A	C	0.0000
104	G	C	0.0000
105	R	C	0.0000
106	I	C	0.0000
107	I	C	0.0000
108	T	C	0.0000
109	E	C	0.0000
110	S	C	0.0000
111	L	C	0.0000
112	N	C	-0.1282
113	T	C	0.0000
114	S	C	0.0000
115	Q	C	0.0000
116	Y	C	0.3848
117	T	C	0.2838
118	Y	C	0.0000
119	E	C	0.0000
120	I	C	0.0000
121	A	C	0.0000
122	P	C	0.0000
123	V	C	0.0000
124	F	C	0.0000
125	V	C	0.0000
126	L	C	0.0000
127	M	C	0.0000
128	E	C	0.0000
129	E	C	-1.6256
130	E	C	-1.9666
131	V	C	0.0000
132	L	C	0.0000
133	K	C	-2.4300
134	K	C	-1.8356
135	L	C	0.0000
136	R	C	-1.3684
137	A	C	-1.0825
138	L	C	-0.5192
139	V	C	0.0000
140	G	C	-1.1038
141	W	C	0.0000
142	N	C	-1.8405
143	S	C	-1.4629
144	G	C	-1.3525
145	D	C	-1.1907
146	G	C	0.0000
147	V	C	0.0000
148	F	C	0.0000
149	C	C	0.0000
150	P	C	0.0000
151	G	C	0.0000
152	G	C	-0.0633
153	S	C	0.0000
154	I	C	0.0000
155	S	C	0.0000
156	N	C	0.0000
157	M	C	0.0000
158	Y	C	0.0000
159	A	C	0.0000
160	M	C	0.0000
161	N	C	0.0000
162	L	C	0.0000
163	A	C	0.0000
164	R	C	0.0000
165	F	C	0.0000
166	Q	C	-1.3285
167	R	C	-1.0174
168	Y	C	-0.7384
169	P	C	-1.7413
170	D	C	-2.5164
171	C	C	0.0000
172	K	C	-2.1145
173	Q	C	-2.9894
174	R	C	-3.4011
175	G	C	0.0000
176	L	C	0.0000
177	R	C	-1.7748
178	A	C	-1.4184
179	L	C	0.0000
180	P	C	-0.3754
181	P	C	-0.9417
182	L	C	0.0000
183	A	C	0.0000
184	L	C	0.0000
185	F	C	0.0000
186	T	C	0.0000
187	S	C	0.0000
188	K	C	-1.7524
189	E	C	-0.9503
190	C	C	-0.2497
191	H	C	-0.1258
192	Y	C	-0.0055
193	S	C	0.0000
194	I	C	0.0000
195	T	C	-0.5077
196	K	C	0.0000
197	G	C	0.0000
198	A	C	0.0000
199	A	C	0.0000
200	F	C	0.0000
201	L	C	0.0000
202	G	C	0.0000
203	L	C	0.0000
204	G	C	0.0000
205	T	C	-1.9148
206	D	C	-2.5947
207	S	C	0.0000
208	V	C	0.0000
209	R	C	-0.3847
210	V	C	-0.0231
211	V	C	0.0000
212	K	C	-2.3833
213	A	C	-1.8471
214	D	C	-2.1080
215	E	C	-2.6592
216	R	C	-2.4553
217	G	C	0.0000
218	R	C	-1.4504
219	M	C	0.0000
220	I	C	-1.0183
221	P	C	-1.5389
222	E	C	-2.6274
223	D	C	-1.9789
224	L	C	0.0000
225	E	C	-1.7105
226	R	C	-2.0918
227	Q	C	-1.2494
228	I	C	0.0000
229	I	C	-0.0037
230	L	C	-0.5215
231	A	C	0.0000
232	E	C	-1.9416
233	A	C	-1.6386
234	E	C	-2.4427
235	G	C	-2.2388
236	S	C	-1.0230
237	V	C	-0.3450
238	P	C	0.0000
239	F	C	0.0000
240	L	C	0.0000
241	V	C	0.0000
242	S	C	0.0000
243	A	C	0.0000
244	T	C	0.0000
245	S	C	0.0000
246	G	C	0.0000
247	T	C	0.0000
248	T	C	0.0339
249	V	C	0.0475
250	L	C	0.0000
251	G	C	0.0000
252	A	C	0.0000
253	F	C	0.0000
254	D	C	0.0000
255	P	C	-0.5253
256	L	C	0.0000
257	D	C	-1.4675
258	A	C	-0.8893
259	I	C	0.0000
260	A	C	0.0000
261	D	C	-1.4446
262	V	C	0.0000
263	C	C	0.0000
264	Q	C	-1.8273
265	R	C	-1.8729
266	H	C	-1.1942
267	G	C	-1.0983
268	L	C	0.0000
269	W	C	0.0000
270	F	C	0.0000
271	H	C	0.0000
272	V	C	0.0000
273	D	C	0.0000
274	A	C	0.0000
275	A	C	-0.0699
276	W	C	0.0000
277	G	C	0.0000
278	G	C	0.0000
279	S	C	0.0000
280	V	C	0.0000
281	L	C	0.0000
282	L	C	0.0000
283	S	C	0.0000
284	R	C	-2.3549
285	T	C	-1.4664
286	H	C	-1.3795
287	R	C	-2.1869
288	H	C	-2.3070
289	L	C	-1.1847
290	L	C	0.0000
291	D	C	-2.6229
292	G	C	0.0000
293	I	C	0.0000
294	Q	C	-1.5339
295	R	C	-1.4233
296	A	C	0.0000
297	D	C	-0.7580
298	S	C	0.0000
299	V	C	0.0000
300	A	C	0.0000
301	W	C	0.0000
302	N	C	0.0000
303	P	C	0.0000
304	H	C	0.0000
305	K	C	-0.2860
306	L	C	0.0000
307	L	C	0.0000
308	A	C	0.0000
309	A	C	0.0000
310	G	C	0.0000
311	L	C	0.0000
312	Q	C	0.0000
313	C	C	0.0000
314	S	C	0.0000
315	A	C	0.0000
316	L	C	0.0000
317	L	C	0.0000
318	L	C	0.0000
319	R	C	-1.2969
320	D	C	-0.9279
321	T	C	-0.7776
322	S	C	-1.3225
323	N	C	-1.9210
324	L	C	0.0000
325	L	C	0.0000
326	K	C	-1.7377
327	R	C	-2.2897
328	C	C	0.0000
329	H	C	0.0000
330	G	C	-1.3236
331	S	C	-0.9279
332	Q	C	-1.3505
333	A	C	-0.8180
338	Q	C	-2.5135
339	Q	C	-2.8427
340	D	C	-2.9083
341	K	C	-2.0980
342	F	C	-1.0541
343	Y	C	0.0000
344	D	C	-1.8291
345	V	C	-0.9653
346	A	C	-0.4451
347	L	C	-0.2381
348	D	C	-0.3442
349	T	C	0.0000
350	G	C	-0.3453
351	D	C	-1.3172
352	K	C	-1.0429
353	V	C	0.0000
354	V	C	0.0000
355	Q	C	0.0000
356	C	C	0.2412
357	G	C	0.0890
358	R	C	0.0000
359	R	C	0.0000
360	V	C	0.0000
361	D	C	0.0000
362	C	C	0.0000
363	L	C	0.0000
364	K	C	0.0000
365	L	C	0.0000
366	W	C	0.0000
367	L	C	0.0000
368	M	C	0.0000
369	W	C	0.0000
370	K	C	0.0000
371	A	C	-0.9104
372	Q	C	-1.2246
373	G	C	0.0000
374	G	C	-1.4052
375	Q	C	-2.0403
376	G	C	-1.7086
377	L	C	0.0000
378	E	C	0.0000
379	R	C	-2.7021
380	R	C	-1.7657
381	I	C	0.0000
382	D	C	-1.6738
383	Q	C	-1.7323
384	A	C	0.0000
385	F	C	-0.9141
386	A	C	-0.9011
387	L	C	0.0000
388	T	C	0.0000
389	R	C	-2.2519
390	Y	C	-1.7215
391	L	C	0.0000
392	V	C	0.0000
393	E	C	-3.3028
394	E	C	0.0000
395	I	C	0.0000
396	K	C	-3.6113
397	K	C	-3.6387
398	R	C	-2.9856
399	E	C	-2.9480
400	G	C	0.0000
401	F	C	0.0000
402	E	C	-1.2053
403	L	C	-0.5813
404	V	C	-0.3317
405	M	C	-1.1897
406	E	C	-1.9464
407	P	C	-1.3832
408	E	C	-0.8982
409	F	C	0.0000
410	V	C	0.0000
411	N	C	0.0000
412	V	C	0.0000
413	C	C	0.0000
414	F	C	0.0000
415	W	C	0.0000
416	F	C	0.0000
417	V	C	0.0000
418	P	C	0.0000
419	P	C	-1.5153
420	S	C	-1.2830
421	L	C	0.0000
422	R	C	-1.9411
423	G	C	-2.2665
424	K	C	-3.3037
425	K	C	-3.6870
426	E	C	-3.3895
427	S	C	-2.6323
428	P	C	-2.1274
429	D	C	-2.8560
430	Y	C	0.0000
431	S	C	-2.6243
432	Q	C	-3.0255
433	R	C	-3.1513
434	L	C	0.0000
435	S	C	0.0000
436	Q	C	-2.3304
437	V	C	0.0000
438	A	C	0.0000
439	P	C	0.0000
440	V	C	-0.1192
441	L	C	0.0000
442	K	C	0.0000
443	E	C	-1.3111
444	R	C	-1.6362
445	M	C	0.0000
446	V	C	0.0000
447	K	C	-2.7368
448	K	C	-2.4560
449	G	C	0.0000
450	T	C	-1.3653
451	M	C	0.0000
452	M	C	0.0000
453	I	C	0.0000
454	G	C	-0.1957
455	Y	C	0.0000
456	Q	C	-1.0361
457	P	C	-0.7208
458	H	C	-0.5506
459	G	C	-0.5277
460	T	C	-0.4657
461	R	C	-1.2337
462	A	C	0.0000
463	N	C	0.0000
464	F	C	0.0000
465	F	C	0.0000
466	R	C	-0.2436
467	M	C	0.0000
468	V	C	0.0000
469	V	C	0.0000
470	A	C	0.0000
471	N	C	0.0000
472	P	C	0.1447
473	I	C	1.1827
474	L	C	0.0000
475	A	C	-0.3466
476	Q	C	-1.1224
477	A	C	-0.5919
478	D	C	0.0000
479	I	C	0.0000
480	D	C	-0.7956
481	F	C	-0.1776
482	L	C	0.0000
483	L	C	0.0000
484	G	C	-0.2184
485	E	C	0.0000
486	L	C	0.0000
487	E	C	-0.9545
488	L	C	0.1293
489	L	C	0.0000
490	G	C	0.0000
491	Q	C	-1.8774
492	D	C	-2.1939
493	L	C	-1.3390
14	P	D	0.5619
15	V	D	1.4754
16	A	D	0.5405
17	V	D	0.2455
18	E	D	-0.8054
19	A	D	-0.3561
20	L	D	0.0000
21	L	D	0.0000
22	Q	D	-1.1837
23	D	D	-1.2942
24	V	D	0.0000
25	F	D	0.0000
26	G	D	-1.1698
27	I	D	0.0000
28	V	D	0.0000
29	V	D	0.0000
30	D	D	-1.9998
31	E	D	-1.8001
32	A	D	0.0000
33	I	D	0.0000
34	L	D	-1.1361
35	K	D	-2.0580
36	G	D	0.0000
37	T	D	-0.5594
38	S	D	-1.0029
39	A	D	-0.9667
40	S	D	-1.3826
41	E	D	-2.4945
42	K	D	-2.9217
43	V	D	0.0000
44	C	D	0.0000
45	E	D	-1.7894
46	W	D	-1.7619
47	K	D	-1.9557
48	E	D	-2.8371
49	P	D	-2.5649
50	E	D	-3.4280
51	E	D	-3.1756
52	L	D	0.0000
53	K	D	-3.2599
54	Q	D	-2.8950
55	L	D	-1.2349
56	L	D	0.0000
57	D	D	-2.4830
58	L	D	0.0000
59	E	D	-2.7269
60	L	D	0.0000
61	Q	D	-2.1425
62	S	D	-1.5950
63	Q	D	-2.0437
64	G	D	-1.7514
65	E	D	-1.8043
66	S	D	-1.8484
67	R	D	-2.3744
68	E	D	-3.1894
69	Q	D	-2.8740
70	I	D	0.0000
71	L	D	-2.0852
72	E	D	-2.6327
73	R	D	-1.9832
74	C	D	0.0000
75	R	D	-1.6814
76	T	D	-0.9463
77	V	D	0.0000
78	I	D	0.0000
79	H	D	-1.0912
80	Y	D	-0.4641
81	S	D	0.0000
82	V	D	0.0000
83	K	D	-0.9529
84	T	D	0.0000
85	G	D	0.0000
86	H	D	0.0000
87	P	D	0.0000
88	R	D	-0.4907
89	F	D	0.0000
90	F	D	0.0000
91	N	D	0.0000
92	Q	D	-0.2166
93	L	D	0.0000
94	F	D	0.0000
95	S	D	0.0000
96	G	D	0.0000
97	L	D	0.3616
98	D	D	0.0000
99	P	D	-0.1070
100	H	D	-0.1054
101	A	D	0.0000
102	L	D	0.0000
103	A	D	0.0000
104	G	D	0.0000
105	R	D	0.0000
106	I	D	0.0000
107	I	D	0.0000
108	T	D	0.0000
109	E	D	0.0000
110	S	D	0.0000
111	L	D	0.0000
112	N	D	-0.1238
113	T	D	0.0000
114	S	D	0.0000
115	Q	D	0.0000
116	Y	D	0.0108
117	T	D	0.0750
118	Y	D	0.0000
119	E	D	-0.0943
120	I	D	0.0000
121	A	D	0.0000
122	P	D	-0.3374
123	V	D	0.0000
124	F	D	0.0000
125	V	D	0.0000
126	L	D	0.0000
127	M	D	0.0000
128	E	D	0.0000
129	E	D	-2.0186
130	E	D	0.0000
131	V	D	0.0000
132	L	D	0.0000
133	K	D	-2.5014
134	K	D	-1.8212
135	L	D	0.0000
136	R	D	-1.4650
137	A	D	-1.1234
138	L	D	-0.5308
139	V	D	0.0000
140	G	D	-1.1805
141	W	D	0.0000
142	N	D	-1.9384
143	S	D	-1.5689
144	G	D	-1.6310
145	D	D	-1.4287
146	G	D	0.0000
147	V	D	0.0000
148	F	D	0.0000
149	C	D	0.0000
150	P	D	0.0000
151	G	D	-0.0940
152	G	D	-0.0932
153	S	D	0.0000
154	I	D	0.0000
155	S	D	0.0000
156	N	D	0.0000
157	M	D	0.0000
158	Y	D	0.0000
159	A	D	0.0000
160	M	D	0.0000
161	N	D	0.0000
162	L	D	0.0000
163	A	D	0.0000
164	R	D	0.0000
165	F	D	-1.0435
166	Q	D	-1.4431
167	R	D	-1.3925
168	Y	D	-1.0147
169	P	D	-1.6977
170	D	D	-2.4118
171	C	D	0.0000
172	K	D	-1.4640
173	Q	D	0.0000
174	R	D	-2.1891
175	G	D	0.0000
176	L	D	0.0000
177	R	D	-2.5752
178	A	D	-1.6328
179	L	D	0.0000
180	P	D	-0.6198
181	P	D	-1.2525
182	L	D	0.0000
183	A	D	0.0000
184	L	D	0.0000
185	F	D	0.0000
186	T	D	0.0000
187	S	D	0.0000
188	K	D	-1.6922
189	E	D	-0.9466
190	C	D	-0.1306
191	H	D	0.0404
192	Y	D	0.3233
193	S	D	0.0000
194	I	D	0.0000
195	T	D	-0.2871
196	K	D	0.0000
197	G	D	0.0000
198	A	D	0.0000
199	A	D	-0.6558
200	F	D	0.0000
201	L	D	0.0000
202	G	D	0.0000
203	L	D	0.0000
204	G	D	0.0000
205	T	D	-1.5984
206	D	D	-2.3754
207	S	D	0.0000
208	V	D	-0.1783
209	R	D	0.1562
210	V	D	0.5778
211	V	D	0.0000
212	K	D	-2.2507
213	A	D	-1.8241
214	D	D	-2.1645
215	E	D	-2.5284
216	R	D	-2.0858
217	G	D	0.0000
218	R	D	-1.5408
219	M	D	0.0000
220	I	D	-1.0340
221	P	D	-1.6292
222	E	D	-2.3830
223	D	D	0.0000
224	L	D	0.0000
225	E	D	-1.3089
226	R	D	-1.4846
227	Q	D	-0.6676
228	I	D	0.0000
229	I	D	0.5047
230	L	D	0.0380
231	A	D	0.0000
232	E	D	-1.5984
233	A	D	-1.0698
234	E	D	-2.0980
235	G	D	-1.7482
236	S	D	-0.9071
237	V	D	-0.2692
238	P	D	0.0000
239	F	D	0.0000
240	L	D	0.0000
241	V	D	0.0000
242	S	D	0.0000
243	A	D	0.0000
244	T	D	0.0000
245	S	D	0.0000
246	G	D	0.0000
247	T	D	0.0000
248	T	D	0.0220
249	V	D	0.0943
250	L	D	0.0000
251	G	D	0.0000
252	A	D	0.0000
253	F	D	0.0000
254	D	D	0.0000
255	P	D	-0.6707
256	L	D	0.0000
257	D	D	-2.1293
258	A	D	-1.4092
259	I	D	0.0000
260	A	D	0.0000
261	D	D	-2.9084
262	V	D	0.0000
263	C	D	0.0000
264	Q	D	-2.9367
265	R	D	-3.1205
266	H	D	-1.8765
267	G	D	-1.6255
268	L	D	0.0000
269	W	D	0.0000
270	F	D	0.0000
271	H	D	0.0000
272	V	D	0.0000
273	D	D	0.0000
274	A	D	0.0000
275	A	D	-0.0763
276	W	D	0.0000
277	G	D	0.0000
278	G	D	0.0000
279	S	D	0.0000
280	V	D	0.0000
281	L	D	0.0000
282	L	D	0.0000
283	S	D	0.0000
284	R	D	-2.2931
285	T	D	-1.4027
286	H	D	-1.2772
287	R	D	-1.9105
288	H	D	-2.1590
289	L	D	-1.0833
290	L	D	0.0000
291	D	D	-2.6430
292	G	D	0.0000
293	I	D	0.0000
294	Q	D	-1.7271
295	R	D	-1.8742
296	A	D	0.0000
297	D	D	-1.0278
298	S	D	0.0000
299	V	D	0.0000
300	A	D	0.0000
301	W	D	0.0000
302	N	D	0.0000
303	P	D	0.0000
304	H	D	0.0000
305	K	D	-0.2963
306	L	D	0.0000
307	L	D	0.0000
308	A	D	0.0000
309	A	D	0.0000
310	G	D	0.0000
311	L	D	0.0000
312	Q	D	0.0000
313	C	D	0.0000
314	S	D	0.0000
315	A	D	0.0000
316	L	D	0.0000
317	L	D	0.0000
318	L	D	0.0000
319	R	D	-1.9544
320	D	D	-1.4056
321	T	D	-1.0819
322	S	D	-1.4054
323	N	D	-2.2592
324	L	D	0.0000
325	L	D	0.0000
326	K	D	-2.7254
327	R	D	-2.4390
328	C	D	0.0000
329	H	D	0.0000
330	G	D	-1.3769
331	S	D	-0.7130
338	Q	D	-2.3859
339	Q	D	-2.7732
340	D	D	-2.9836
341	K	D	-2.0049
342	F	D	-1.0751
343	Y	D	0.0000
344	D	D	-1.8404
345	V	D	-0.6118
346	A	D	-0.1169
347	L	D	-0.3449
348	D	D	-0.3895
349	T	D	-0.4695
350	G	D	-0.6909
351	D	D	-1.5739
352	K	D	-1.5841
353	V	D	0.0000
354	V	D	0.0000
355	Q	D	0.0000
356	C	D	-0.0214
357	G	D	-0.0709
358	R	D	0.0000
359	R	D	0.0000
360	V	D	0.0000
361	D	D	0.0000
362	C	D	0.0000
363	L	D	0.0000
364	K	D	0.0000
365	L	D	0.0000
366	W	D	0.0000
367	L	D	0.0000
368	M	D	0.0000
369	W	D	0.0000
370	K	D	0.0000
371	A	D	-0.9762
372	Q	D	-1.2796
373	G	D	0.0000
374	G	D	-1.2826
375	Q	D	-1.6783
376	G	D	-1.5539
377	L	D	0.0000
378	E	D	0.0000
379	R	D	-2.5845
380	R	D	-1.5561
381	I	D	0.0000
382	D	D	-1.8789
383	Q	D	-1.8350
384	A	D	0.0000
385	F	D	0.0000
386	A	D	-1.0975
387	L	D	0.0000
388	T	D	0.0000
389	R	D	-1.9976
390	Y	D	-1.4238
391	L	D	0.0000
392	V	D	-2.0437
393	E	D	-2.8202
394	E	D	-2.8101
395	I	D	0.0000
396	K	D	-3.5657
397	K	D	-3.7001
398	R	D	-3.1542
399	E	D	-3.0961
400	G	D	0.0000
401	F	D	0.0000
402	E	D	-1.2529
403	L	D	-0.5447
404	V	D	-0.2018
405	M	D	-1.0916
406	E	D	-1.8537
407	P	D	-1.3076
408	E	D	-0.8820
409	F	D	0.0000
410	V	D	0.0000
411	N	D	0.0000
412	V	D	0.0000
413	C	D	0.0000
414	F	D	0.0000
415	W	D	0.0210
416	F	D	0.0000
417	V	D	0.0000
418	P	D	0.0000
419	P	D	-1.4391
420	S	D	-1.1421
421	L	D	0.0000
422	R	D	-2.0171
423	G	D	-2.2717
424	K	D	-3.3271
425	K	D	-3.7134
426	E	D	-3.3798
427	S	D	-2.4932
428	P	D	-1.9540
429	D	D	-2.5616
430	Y	D	0.0000
431	S	D	-2.3048
432	Q	D	-2.3142
433	R	D	-1.9943
434	L	D	0.0000
435	S	D	-1.3331
436	Q	D	-1.4005
437	V	D	0.0000
438	A	D	0.0000
439	P	D	-0.5707
440	V	D	-0.0027
441	L	D	0.0000
442	K	D	0.0000
443	E	D	-1.4514
444	R	D	-1.5981
445	M	D	0.0000
446	V	D	0.0000
447	K	D	-2.9906
448	K	D	-2.9653
449	G	D	0.0000
450	T	D	-1.5865
451	M	D	0.0000
452	M	D	0.0000
453	I	D	0.0000
454	G	D	-0.0454
455	Y	D	-0.0192
456	Q	D	-0.4963
457	P	D	-0.7479
458	H	D	-0.7191
459	G	D	-1.0080
460	T	D	-0.6670
461	R	D	-1.0164
462	A	D	-1.1384
463	N	D	-0.9934
464	F	D	0.0000
465	F	D	0.0000
466	R	D	-0.1504
467	M	D	0.0000
468	V	D	0.0000
469	V	D	0.0000
470	A	D	0.0000
471	N	D	0.0000
472	P	D	0.3943
473	I	D	1.4613
474	L	D	0.0000
475	A	D	-0.2676
476	Q	D	-1.1899
477	A	D	-0.6997
478	D	D	0.0000
479	I	D	0.0000
480	D	D	-1.1908
481	F	D	-0.2902
482	L	D	0.0000
483	L	D	0.0000
484	G	D	-0.1547
485	E	D	0.0000
486	L	D	0.0000
487	E	D	-0.6135
488	L	D	0.4772
489	L	D	0.0000
490	G	D	0.0000
491	Q	D	-1.7598
492	D	D	-2.1471
493	L	D	-1.1245

3Dmol can be expensive computationally for big molecules. If you experience lag or delay click on the "Play the video" button instead.

Download PDB file

View in 3Dmol

Start animation

Play the video

Automated mutations analysis

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file.

Mutant	Energetic effect	Score comparison
VE15A	-0.8844	-0.0042	View	CSV	PDB
VR15C	-0.6426	-0.0021	View	CSV	PDB
VD15A	-0.9922	-0.0009	View	CSV	PDB
VR15D	-0.2727	-0.0006	View	CSV	PDB
VK15C	-0.4531	-0.0003	View	CSV	PDB
IR473C	-2.1139	0.0038	View	CSV	PDB
VD15D	-1.1441	0.0021	View	CSV	PDB
IK473B	-0.2788	0.0011	View	CSV	PDB
IR473B	-0.1565	0.0014	View	CSV	PDB
IK473C	-0.0516	0.0049	View	CSV	PDB
IR473D	0.4465	0.0029	View	CSV	PDB
ID473D	0.5922	0.0029	View	CSV	PDB

Project name: ???

Status: done

Started: 2025-02-27 12:20:13

Automated mutations analysis

Mutant

Energetic effect

Score comparison