Project name: TaCP2

Status: done

Started: 2026-07-02 06:20:39
Settings
Chain sequence(s) A: MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKPIENERMQRARFMRQSNFGTIGQTPETSLAQTESSKKFLRSEELRQRLMSESEAASESRSPSAAAMGPETSGPGPGKVKVSVTTLGPGPGVLFSGTLRFAAYGDLPVTFWEGQGVGLGPGPGVSAYSFSITAYFPEG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:26)
Show buried residues

Minimal score value
-3.8576
Maximal score value
5.8973
Average score
-0.3837
Total score value
-78.6571

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3828
2 R A 0.5237
3 V A 2.8543
4 L A 3.5361
5 Y A 3.5978
6 L A 3.8176
7 L A 4.4122
8 F A 5.4627
9 S A 4.8584
10 F A 5.7018
11 L A 5.6500
12 F A 5.8858
13 I A 5.8973
14 F A 5.6328
15 L A 4.7646
16 M A 3.6993
17 P A 2.6004
18 L A 2.9580
19 P A 1.1452
20 G A 1.1278
21 V A 2.5797
22 F A 2.4757
23 G A 0.5903
24 G A 0.0510
25 I A -0.3120
26 G A -0.7863
27 D A -0.8265
28 P A -0.0893
29 V A 0.3817
30 T A -0.5833
31 C A 0.0000
32 L A 0.2756
33 K A -1.1405
34 S A -0.6076
35 G A -0.8820
36 A A 0.0000
37 I A 0.2839
38 C A 0.6396
39 H A 0.3395
40 P A 0.9018
41 V A 2.0447
42 F A 1.6629
43 C A -0.3855
44 P A -1.4035
45 R A -2.8097
46 R A -3.3516
47 Y A -2.7338
48 K A -2.8671
49 Q A -1.7372
50 I A -0.7937
51 G A -0.9378
52 T A -0.8160
53 C A 0.0000
54 G A -0.4208
55 L A 0.5577
56 P A 0.1637
57 G A 0.2924
58 T A 0.3660
59 K A -0.2771
60 C A 0.0000
61 C A 0.0000
62 K A -2.1941
63 K A -3.2123
64 P A -2.6103
65 E A -2.5882
66 A A -1.5777
67 A A -1.0150
68 K A -1.7920
69 P A -0.7597
70 I A 0.0735
71 E A -2.3131
72 N A -2.7934
73 E A -3.7871
74 R A -3.8576
75 M A -2.3810
76 Q A -3.0725
77 R A -3.1226
78 A A -2.1252
79 R A -2.4213
80 F A -0.5923
81 M A -0.5719
82 R A -2.3174
83 Q A -1.7272
84 S A -0.8546
85 N A -1.0336
86 F A 0.6916
87 G A 0.2319
88 T A 0.7782
89 I A 1.6498
90 G A -0.1458
91 Q A -1.2654
92 T A -1.3422
93 P A -1.4884
94 E A -1.9141
95 T A -0.8765
96 S A -0.3256
97 L A 0.4298
98 A A -0.6260
99 Q A -1.6458
100 T A -1.7794
101 E A -2.6531
102 S A -1.6378
103 S A -1.5165
104 K A -2.6503
105 K A -2.3990
106 F A -0.1001
107 L A -0.2143
108 R A -2.4181
109 S A -1.8031
110 E A -2.6774
111 E A -2.9528
112 L A -1.6327
113 R A -2.9855
114 Q A -3.0605
115 R A -2.8062
116 L A -1.1560
117 M A -1.0334
118 S A -2.0089
119 E A -2.4768
120 S A -1.8540
121 E A -2.6037
122 A A -2.0520
123 A A -2.0637
124 S A -2.4920
125 E A -2.9993
126 S A -2.2858
127 R A -2.7129
128 S A -1.8151
129 P A -0.9685
130 S A -0.5854
131 A A 0.6533
132 A A 0.4689
133 A A 0.6385
134 M A 0.6702
135 G A -0.6408
136 P A -1.2447
137 E A -2.4645
138 T A -1.6095
139 S A -1.3681
140 G A -0.9910
141 P A -0.7505
142 G A -0.7351
143 P A -0.9745
144 G A -1.6946
145 K A -2.7814
146 V A -2.0365
147 K A -2.4938
148 V A -0.6472
149 S A 0.2908
150 V A 1.6313
151 T A 0.9330
152 T A 1.0448
153 L A 1.6572
154 G A 0.4973
155 P A -0.1468
156 G A -0.3671
157 P A -0.3329
158 G A -0.1551
159 V A 0.0000
160 L A 0.7538
161 F A 0.0000
162 S A 0.2711
163 G A 0.0000
164 T A -1.4164
165 L A 0.0000
166 R A -2.6157
167 F A -0.8168
168 A A -0.4133
169 A A 0.2348
170 Y A 0.7700
171 G A -0.8313
172 D A -2.1386
173 L A -0.5019
174 P A -0.7985
175 V A 0.0519
176 T A 0.2055
177 F A 0.0000
178 W A -0.0177
179 E A -1.0135
180 G A -1.2277
181 Q A -1.3750
182 G A -1.0222
183 V A -0.2919
184 G A -0.4785
185 L A -0.0693
186 G A -0.4951
187 P A -0.5685
188 G A -0.5690
189 P A -0.5702
190 G A -0.6032
191 V A -0.2274
192 S A -0.3152
193 A A -0.1613
194 Y A 0.1955
195 S A -0.1386
196 F A 0.0253
197 S A -0.5914
198 I A -0.1347
199 T A 0.1693
200 A A 1.1350
201 Y A 2.0976
202 F A 1.9049
203 P A 0.0215
204 E A -1.4760
205 G A -1.1297
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018