Project name: vpooniaji

Status: done

Started: 2024-12-28 08:42:11
Settings
Chain sequence(s) A: KGFVVEEMMRFVVAMRLHTRDDQQAREEGEEKKEEVVKKQQPPEEEEKAVTTKWDPSVEGYLKFLVDSKLVYDTLEKIVQEAPHPSYAEFRNTGLERSSASSLAEDLEWFKEQGGYTIPEPSSSPGLTYAQYLKELLSVKDPQAFIICHFYNIYFAHSAGGRMMIGKKVAEKLLNNKALEFYKWDDDLPRLLQNNVRDKLNKVVAEPWSRREEKDHCLEETEKSFKLSSGEILRLILS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:37)
Show buried residues

Minimal score value
-4.5697
Maximal score value
0.9576
Average score
-1.3249
Total score value
-276.9132

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
16 K A -2.3808
17 G A -2.4428
18 F A 0.0000
20 E A -2.1241
21 E A -1.0490
22 M A 0.0000
23 R A -0.6203
24 F A 0.6311
25 V A 0.0000
26 A A 0.0000
27 M A -1.4185
28 R A -2.3455
29 L A -1.6287
30 H A -2.5574
31 T A 0.0000
32 R A -4.5697
33 D A -2.8080
34 Q A -2.4475
35 A A -2.9766
36 R A -3.7880
37 E A -3.7922
39 E A -4.4334
40 K A -4.0081
41 E A -3.5203
42 V A -2.2085
43 K A -2.4181
44 Q A -1.8739
45 P A -1.3225
46 E A 0.0000
47 E A -1.9079
48 K A -1.9917
49 A A -1.2855
50 V A 0.0000
51 T A -1.4619
52 K A -2.3705
53 W A 0.0000
54 D A -2.2594
55 P A -1.4674
56 S A -0.9587
57 V A -0.6870
58 E A -1.7670
59 G A 0.0000
60 Y A 0.0000
61 L A 0.0000
62 K A -1.3973
63 F A 0.0000
64 L A 0.0000
65 V A 0.0000
66 D A 0.0000
67 S A -0.0698
68 K A -0.3039
69 L A 0.2279
70 V A 0.0000
71 Y A 0.0000
72 D A -1.0650
73 T A 0.0000
74 L A 0.0000
75 E A -2.3152
76 K A -3.1257
77 I A 0.0000
78 V A 0.0000
79 Q A -3.3584
80 E A -3.1017
81 A A -1.9114
82 P A -0.7361
83 H A -0.6410
84 P A -1.1421
85 S A -1.1038
86 Y A 0.0000
87 A A -2.0612
88 E A -2.7276
89 F A 0.0000
90 R A -2.7771
91 N A -2.2817
92 T A -1.5418
93 G A -1.6785
94 L A 0.0000
95 E A -0.9853
96 R A 0.0000
97 S A -0.5802
98 A A -0.7472
99 S A 0.0000
100 L A 0.0000
101 A A -1.4380
102 E A -2.7512
103 D A 0.0000
104 L A -2.0053
105 E A -3.3935
106 W A -2.5423
107 F A 0.0000
108 K A -3.4848
109 E A -3.4895
110 Q A -2.5783
111 G A -1.8895
112 Y A -1.1946
113 T A -0.8882
114 I A -0.9003
115 P A -1.1187
116 E A -1.9346
117 P A -0.7930
118 S A -0.4297
119 S A -0.1405
120 P A -0.3398
121 G A 0.0000
122 L A 0.9576
123 T A 0.0878
124 Y A 0.0000
125 A A 0.0000
126 Q A -1.4733
127 Y A -1.0043
128 L A 0.0000
129 K A -2.1098
130 E A -2.3641
131 L A 0.0000
132 S A 0.0000
133 V A 0.0390
134 K A -1.5786
135 D A -1.1149
136 P A -0.5003
137 Q A -1.3186
138 A A 0.0000
139 F A 0.0000
140 I A 0.0000
141 C A 0.0000
142 H A 0.0000
143 F A 0.0000
144 Y A 0.0000
145 N A 0.0000
146 I A 0.0000
147 Y A 0.0000
148 F A 0.0000
149 A A -0.1219
150 H A 0.0000
151 S A -0.4100
152 A A -0.2661
153 G A -0.5800
154 G A -0.6440
155 R A -1.5661
156 M A -0.8140
157 I A -0.9039
158 G A 0.0000
159 K A -2.8031
160 K A -2.5564
161 V A 0.0000
162 A A 0.0000
163 E A -3.5904
164 K A -2.5742
165 L A -1.3414
166 L A 0.0000
167 N A -2.5445
168 N A -3.0648
169 K A -2.1790
170 A A -1.6852
171 L A 0.0000
172 E A -2.0710
173 F A 0.0000
174 Y A -1.3934
175 K A -2.5135
176 W A -2.3771
177 D A -3.0948
178 D A -3.5676
179 D A -2.8409
180 L A -2.0835
181 P A -1.8359
182 R A -2.9930
183 L A -2.2021
184 L A -1.6302
185 Q A -2.3591
186 N A -2.7196
187 V A 0.0000
188 R A -2.5621
189 D A -2.6425
190 K A -2.9110
191 L A 0.0000
192 N A -2.9929
193 K A -3.2196
194 V A -2.0039
195 A A 0.0000
196 E A -3.0224
197 P A -1.6437
198 W A -1.8078
199 S A -2.1877
200 R A -3.1888
201 E A -3.4920
202 E A -2.9990
203 K A -2.8816
204 D A -3.2855
205 H A -2.9733
206 C A 0.0000
207 L A -1.7466
208 E A -2.7991
209 E A -1.8548
210 T A 0.0000
211 E A -1.9159
212 K A -2.1480
213 S A 0.0000
214 F A -1.1685
215 K A -2.2812
216 L A -1.2890
217 S A -1.0221
218 G A -1.3594
219 E A -1.6769
220 I A 0.0000
221 L A -0.6720
222 R A -1.0221
223 L A 0.0000
224 I A 0.0000
225 L A -0.6640
226 S A -0.7779
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018