Project name: ee65b5b93ce26a7

Chain sequence(s)	E: SFELTQPSSVSVSPGQTANITCSGGYLGETYRSWYQQKPGQSPVLVIYQSSKRPSGIPGRFSGSNSGNTATLTISGTQPLDEADYFCQAWDFTSVVFGGGTKLTVLGQPKAAPSVTLF
Selected Chain(s)	E
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with E chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)

• Minimal score value: -2.9592
• Maximal score value: 3.8526
• Average score: 0.0243
• Total score value: 2.873

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	E	0.3455
2	F	E	1.2547
3	E	E	-0.2619
4	L	E	0.5749
5	T	E	-0.3324
6	Q	E	-1.3940
7	P	E	-0.7158
8	S	E	-0.8425
9	S	E	0.3990
11	V	E	2.1014
12	S	E	1.5111
13	V	E	2.0569
14	S	E	0.7239
15	P	E	0.1707
16	G	E	-0.5245
17	Q	E	-1.0523
18	T	E	-0.7904
19	A	E	-0.3786
20	N	E	-0.2918
21	I	E	1.4431
22	T	E	0.8021
23	C	E	0.8676
24	S	E	0.1043
25	G	E	0.5533
26	G	E	0.4828
27	Y	E	1.5888
28	L	E	1.3657
29	G	E	-0.3305
36	E	E	-1.8821
37	T	E	-1.0302
38	Y	E	0.0402
39	R	E	-1.4700
40	S	E	0.0760
41	W	E	0.9772
42	Y	E	0.8139
43	Q	E	-1.2824
44	Q	E	-2.2847
45	K	E	-2.9592
46	P	E	-2.1127
47	G	E	-1.7973
48	Q	E	-1.7228
49	S	E	-0.4962
50	P	E	0.5342
51	V	E	2.6397
52	L	E	3.3341
53	V	E	3.8526
54	I	E	2.9314
55	Y	E	1.7033
56	Q	E	-0.2856
57	S	E	-0.9701
65	S	E	-1.8970
66	K	E	-2.8480
67	R	E	-2.8964
68	P	E	-1.8979
69	S	E	-1.1009
70	G	E	-0.5168
71	I	E	0.5087
72	P	E	-0.1406
74	G	E	-0.6676
75	R	E	-0.9689
76	F	E	0.7535
77	S	E	-0.1339
78	G	E	-1.0121
79	S	E	-1.2635
80	N	E	-1.7057
83	S	E	-1.4844
84	G	E	-1.7021
85	N	E	-1.6505
86	T	E	-0.6914
87	A	E	-0.2968
88	T	E	-0.0409
89	L	E	1.1773
90	T	E	1.0819
91	I	E	1.2889
92	S	E	0.0513
93	G	E	-0.6302
94	T	E	-0.5007
95	Q	E	-0.9902
96	P	E	-1.1991
97	L	E	-0.4594
98	D	E	-2.4104
99	E	E	-2.7571
100	A	E	-1.7628
101	D	E	-1.5241
102	Y	E	0.6751
103	F	E	1.6971
104	C	E	1.0563
105	Q	E	-0.1338
106	A	E	0.1875
107	W	E	0.2675
108	D	E	-0.5878
109	F	E	1.3766
114	T	E	1.0493
115	S	E	1.2418
116	V	E	2.8623
117	V	E	2.9126
118	F	E	2.5761
119	G	E	0.7785
120	G	E	-0.8788
121	G	E	-0.9359
122	T	E	-0.7189
123	K	E	-0.7840
124	L	E	1.4766
125	T	E	1.5007
126	V	E	2.9780
127	L	E	2.3408
128	G	E	0.5229
129	Q	E	-1.0421
130	P	E	-1.6340
131	K	E	-2.3180
132	A	E	-1.0240
133	A	E	-0.2938
134	P	E	0.1762
135	S	E	0.4257
136	V	E	1.8926
137	T	E	1.8116
138	L	E	2.8332
139	F	E	2.8325