Project name: query_structure

Status: done

Started: 2026-03-17 00:18:01
Settings
Chain sequence(s) A: PQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:45)
Show buried residues

Minimal score value
-3.2615
Maximal score value
2.0836
Average score
-0.7563
Total score value
-26.4718

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A -0.6830
2 Q A -0.9250
3 C A -0.1762
4 V A -1.1462
5 K A -2.6411
6 K A -3.2615
7 D A -2.8621
8 E A -1.8730
9 L A -0.5815
10 C A 0.0000
11 I A 0.4013
12 P A 0.4329
13 Y A 1.9980
14 Y A 2.0836
15 L A 1.3576
16 D A -1.1678
17 C A 0.0000
18 C A -1.6997
19 E A -2.5472
20 P A -1.7326
21 L A -2.0900
22 E A -2.1149
23 C A -1.7965
24 K A -2.2778
25 K A -1.4547
26 V A 0.1494
27 N A -0.2100
28 W A 1.1522
29 W A 1.2385
30 D A -0.0712
31 H A -0.9195
32 K A -1.8136
33 C A 0.0000
34 I A -0.3318
35 G A -0.9084
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018