Project name: eeba16d4e7ee5a0

Status: done

Started: 2026-05-29 02:19:01
Settings
Chain sequence(s) A: MKKTAIAIAVALAGFATVAQAAVDNKFNKEAIFASIEIINLPNLNGHQVHAFIRSLSDDPSQSANLLAEAKKLNDAQAPKGQAGQHHHHHHGAYPYDVPDYAS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)
Show buried residues

Minimal score value
-3.1979
Maximal score value
3.1355
Average score
-0.7015
Total score value
-72.2567

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.2084
2 K A -1.9932
3 K A -2.0775
4 T A -0.7330
5 A A 0.6199
6 I A 2.4151
7 A A 2.2332
8 I A 3.1355
9 A A 2.3509
10 V A 2.7671
11 A A 1.8643
12 L A 2.2693
13 A A 1.4935
14 G A 1.1584
15 F A 2.2619
16 A A 1.4972
17 T A 1.0237
18 V A 1.6966
19 A A 0.2986
20 Q A -0.3331
21 A A 0.1216
22 A A -0.1601
23 V A 0.2616
24 D A -1.8403
25 N A -2.3445
26 K A -2.0245
27 F A -0.4966
28 N A -2.2555
29 K A -2.1770
30 E A -1.8767
31 A A 0.0000
32 I A 0.4628
33 F A 1.2017
34 A A 0.0000
35 S A 0.7217
36 I A 1.6570
37 E A -0.1038
38 I A 0.0000
39 I A 1.1264
40 N A -0.4468
41 L A -0.6670
42 P A -0.8650
43 N A -1.3967
44 L A 0.0000
45 N A -1.8179
46 G A -1.5648
47 H A -1.9273
48 Q A -1.3164
49 V A -0.9126
50 H A -1.6326
51 A A -1.2869
52 F A 0.0000
53 I A -0.6577
54 R A -2.5565
55 S A -1.9486
56 L A 0.0000
57 S A -1.6538
58 D A -2.8458
59 D A -2.2111
60 P A -1.9398
61 S A -1.5161
62 Q A -1.8687
63 S A 0.0000
64 A A -1.0471
65 N A -1.7993
66 L A -1.5004
67 L A -1.0180
68 A A -1.7744
69 E A -2.9415
70 A A 0.0000
71 K A -2.8358
72 K A -3.1979
73 L A -1.9016
74 N A 0.0000
75 D A -3.0831
76 A A -1.7976
77 Q A -1.8162
78 A A -1.7044
79 P A -1.8190
80 K A -2.6446
81 G A -2.0233
82 Q A -2.4630
83 A A -1.6511
84 G A -1.9862
85 Q A -2.6824
86 H A -2.8128
87 H A -2.8583
88 H A -2.8968
89 H A -2.7278
90 H A -2.4547
91 H A -1.9194
92 G A -0.8132
93 A A 0.2979
94 Y A 1.1195
95 P A 0.7112
96 Y A 1.1989
97 D A -0.5165
98 V A 0.8388
99 P A -0.1997
100 D A -1.0791
101 Y A 0.6029
102 A A 0.0182
103 S A -0.0606
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018