Project name: G1G1

Chain sequence(s)	H: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSQLGWFRQAPGKEREFISAVTLVSRTHYADSVKGRFTISRDDSKNTLYLQMNSLKPEDTAMYYCVARAAWGTDYREQGYWGQGTQVTVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -3.2819
• Maximal score value: 1.5395
• Average score: -0.7333
• Total score value: -88.7283

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	H	-2.0046
2	V	H	-0.9329
3	Q	H	-0.9571
4	L	H	0.0000
5	L	H	0.9403
6	E	H	-0.0396
7	S	H	-0.4694
8	G	H	-1.0742
9	G	H	-0.6381
11	G	H	0.1851
12	L	H	1.1003
13	V	H	-0.0050
14	Q	H	-1.3496
15	P	H	-1.6325
16	G	H	-1.4228
17	G	H	-0.9355
18	S	H	-1.1081
19	L	H	-0.6723
20	R	H	-1.5757
21	L	H	0.0000
22	S	H	-0.3324
23	C	H	0.0000
24	A	H	-0.1459
25	A	H	-0.5046
26	S	H	-0.7437
27	G	H	-1.0250
28	F	H	-0.3828
29	T	H	-0.2227
30	F	H	0.0000
35	S	H	-0.0999
36	S	H	0.2012
37	S	H	0.0000
38	Q	H	0.0486
39	L	H	0.0000
40	G	H	0.0000
41	W	H	0.0000
42	F	H	0.0000
43	R	H	0.0000
44	Q	H	-1.7752
45	A	H	-1.8123
46	P	H	-1.3118
47	G	H	-1.8286
48	K	H	-3.1982
49	E	H	-3.2819
50	R	H	-2.1341
51	E	H	-1.5232
52	F	H	-0.2014
53	I	H	0.0000
54	S	H	0.0000
55	A	H	-0.5401
56	V	H	0.0000
57	T	H	0.1045
58	L	H	1.1820
59	V	H	1.5395
63	S	H	-0.0703
64	R	H	-1.4605
65	T	H	-1.0894
66	H	H	-1.5496
67	Y	H	-1.0934
68	A	H	-1.4340
69	D	H	-2.6084
70	S	H	-1.7617
71	V	H	0.0000
72	K	H	-2.7610
74	G	H	-1.7728
75	R	H	-1.6756
76	F	H	0.0000
77	T	H	-0.9242
78	I	H	0.0000
79	S	H	-0.5852
80	R	H	-0.9290
81	D	H	-1.6365
82	D	H	-1.9988
83	S	H	-1.7771
84	K	H	-2.5160
85	N	H	-2.0086
86	T	H	-1.1304
87	L	H	0.0000
88	Y	H	-0.4856
89	L	H	0.0000
90	Q	H	-1.0922
91	M	H	0.0000
92	N	H	-1.3495
93	S	H	-1.2501
94	L	H	0.0000
95	K	H	-2.4896
96	P	H	-1.9959
97	E	H	-2.4059
98	D	H	0.0000
99	T	H	-0.9024
100	A	H	0.0000
101	M	H	-0.4237
102	Y	H	0.0000
103	Y	H	-0.0037
104	C	H	0.0000
105	V	H	0.0000
106	A	H	0.0000
107	R	H	0.0000
108	A	H	-0.5122
109	A	H	-0.5546
110	W	H	-0.5284
111	G	H	-0.6562
111A	T	H	-0.8729
112A	D	H	-1.7378
112	Y	H	-0.7246
113	R	H	-2.0750
114	E	H	-1.7107
115	Q	H	-1.5339
116	G	H	-0.6869
117	Y	H	0.4899
118	W	H	0.5266
119	G	H	0.0298
120	Q	H	-0.8993
121	G	H	-0.5155
122	T	H	-0.6572
123	Q	H	-0.7304
124	V	H	0.0000
125	T	H	-0.2600
126	V	H	0.0000
127	S	H	-0.7957
128	S	H	-0.5625