Aggrescan3D: down

Project name: down_conf

Status: done

Started: 2026-01-20 16:02:04

Settings

Chain sequence(s)	C: LADKIGTEIGPKVSLIDTSSTITIPANIGLLGSKISQSTASINENVNEKCKFTLPPLKIHECNISCPGVSNLVGLPNNICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQRIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNSTYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAVGFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSPKVVFIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISRPGQQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILYRAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCY input PDB
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	Yes
Downloads	Download all the data

Simulation log

Toggle log display

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:09)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:09)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:09)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:10)
[INFO]       Auto_mut: Residue number 118 from chain C and a score of 2.086 (isoleucine) selected  
                       for automated muatation                                                     (00:04:13)
[INFO]       Auto_mut: Residue number 150 from chain C and a score of 2.072 (leucine) selected for 
                       automated muatation                                                         (00:04:13)
[INFO]       Auto_mut: Residue number 124 from chain C and a score of 1.907 (isoleucine) selected  
                       for automated muatation                                                     (00:04:13)
[INFO]       Auto_mut: Residue number 112 from chain C and a score of 1.860 (isoleucine) selected  
                       for automated muatation                                                     (00:04:13)
[INFO]       Auto_mut: Residue number 120 from chain C and a score of 1.712 (isoleucine) selected  
                       for automated muatation                                                     (00:04:13)
[INFO]       Auto_mut: Residue number 205 from chain C and a score of 1.623 (tyrosine) selected    
                       for automated muatation                                                     (00:04:13)
[INFO]       Auto_mut: Mutating residue number 118 from chain C (isoleucine) into glutamic acid    (00:04:13)
[INFO]       Auto_mut: Mutating residue number 118 from chain C (isoleucine) into aspartic acid    (00:04:13)
[INFO]       Auto_mut: Mutating residue number 150 from chain C (leucine) into glutamic acid       (00:04:13)
[INFO]       Auto_mut: Mutating residue number 118 from chain C (isoleucine) into lysine           (00:06:28)
[INFO]       Auto_mut: Mutating residue number 118 from chain C (isoleucine) into arginine         (00:06:29)
[INFO]       Auto_mut: Mutating residue number 150 from chain C (leucine) into lysine              (00:06:33)
[INFO]       Auto_mut: Mutating residue number 150 from chain C (leucine) into aspartic acid       (00:08:57)
[INFO]       Auto_mut: Mutating residue number 124 from chain C (isoleucine) into glutamic acid    (00:09:08)
[INFO]       Auto_mut: Mutating residue number 124 from chain C (isoleucine) into aspartic acid    (00:09:15)
[INFO]       Auto_mut: Mutating residue number 150 from chain C (leucine) into arginine            (00:11:14)
[INFO]       Auto_mut: Mutating residue number 124 from chain C (isoleucine) into lysine           (00:11:31)
[INFO]       Auto_mut: Mutating residue number 124 from chain C (isoleucine) into arginine         (00:11:35)
[INFO]       Auto_mut: Mutating residue number 112 from chain C (isoleucine) into glutamic acid    (00:13:36)
[INFO]       Auto_mut: Mutating residue number 112 from chain C (isoleucine) into aspartic acid    (00:14:10)
[INFO]       Auto_mut: Mutating residue number 120 from chain C (isoleucine) into glutamic acid    (00:14:16)
[INFO]       Auto_mut: Mutating residue number 112 from chain C (isoleucine) into lysine           (00:15:55)
[INFO]       Auto_mut: Mutating residue number 112 from chain C (isoleucine) into arginine         (00:16:36)
[INFO]       Auto_mut: Mutating residue number 120 from chain C (isoleucine) into lysine           (00:16:43)
[INFO]       Auto_mut: Mutating residue number 120 from chain C (isoleucine) into aspartic acid    (00:18:29)
[INFO]       Auto_mut: Mutating residue number 205 from chain C (tyrosine) into glutamic acid      (00:19:06)
[INFO]       Auto_mut: Mutating residue number 205 from chain C (tyrosine) into aspartic acid      (00:19:33)
[INFO]       Auto_mut: Mutating residue number 120 from chain C (isoleucine) into arginine         (00:20:49)
[INFO]       Auto_mut: Mutating residue number 205 from chain C (tyrosine) into lysine             (00:21:34)
[INFO]       Auto_mut: Mutating residue number 205 from chain C (tyrosine) into arginine           (00:21:55)
[INFO]       Auto_mut: Effect of mutation residue number 118 from chain C (isoleucine) into        
                       glutamic acid: Energy difference: 0.4650 kcal/mol, Difference in average    
                       score from the base case: -0.0361                                           (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 118 from chain C (isoleucine) into        
                       lysine: Energy difference: 0.3132 kcal/mol, Difference in average score     
                       from the base case: -0.0275                                                 (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 118 from chain C (isoleucine) into        
                       aspartic acid: Energy difference: 0.7881 kcal/mol, Difference in average    
                       score from the base case: -0.0393                                           (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 118 from chain C (isoleucine) into        
                       arginine: Energy difference: -0.8526 kcal/mol, Difference in average score  
                       from the base case: -0.0324                                                 (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 150 from chain C (leucine) into glutamic  
                       acid: Energy difference: 0.3518 kcal/mol, Difference in average score from  
                       the base case: -0.0204                                                      (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 150 from chain C (leucine) into lysine:   
                       Energy difference: 0.2028 kcal/mol, Difference in average score from the    
                       base case: -0.0202                                                          (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 150 from chain C (leucine) into aspartic  
                       acid: Energy difference: 0.5381 kcal/mol, Difference in average score from  
                       the base case: -0.0191                                                      (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 150 from chain C (leucine) into arginine: 
                       Energy difference: 0.0425 kcal/mol, Difference in average score from the    
                       base case: -0.0217                                                          (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 124 from chain C (isoleucine) into        
                       glutamic acid: Energy difference: 0.5530 kcal/mol, Difference in average    
                       score from the base case: -0.0314                                           (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 124 from chain C (isoleucine) into        
                       lysine: Energy difference: 0.1955 kcal/mol, Difference in average score     
                       from the base case: -0.0299                                                 (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 124 from chain C (isoleucine) into        
                       aspartic acid: Energy difference: 0.9695 kcal/mol, Difference in average    
                       score from the base case: -0.0250                                           (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 124 from chain C (isoleucine) into        
                       arginine: Energy difference: 0.2150 kcal/mol, Difference in average score   
                       from the base case: -0.0329                                                 (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 112 from chain C (isoleucine) into        
                       glutamic acid: Energy difference: 0.2618 kcal/mol, Difference in average    
                       score from the base case: -0.0319                                           (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 112 from chain C (isoleucine) into        
                       lysine: Energy difference: -0.2796 kcal/mol, Difference in average score    
                       from the base case: -0.0299                                                 (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 112 from chain C (isoleucine) into        
                       aspartic acid: Energy difference: 0.8792 kcal/mol, Difference in average    
                       score from the base case: -0.0288                                           (00:24:29)
[INFO]       Auto_mut: Effect of mutation residue number 112 from chain C (isoleucine) into        
                       arginine: Energy difference: -0.1846 kcal/mol, Difference in average score  
                       from the base case: -0.0370                                                 (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 120 from chain C (isoleucine) into        
                       glutamic acid: Energy difference: 0.3787 kcal/mol, Difference in average    
                       score from the base case: -0.0316                                           (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 120 from chain C (isoleucine) into        
                       lysine: Energy difference: -0.0253 kcal/mol, Difference in average score    
                       from the base case: -0.0390                                                 (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 120 from chain C (isoleucine) into        
                       aspartic acid: Energy difference: 0.8641 kcal/mol, Difference in average    
                       score from the base case: -0.0335                                           (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 120 from chain C (isoleucine) into        
                       arginine: Energy difference: -0.6893 kcal/mol, Difference in average score  
                       from the base case: -0.0366                                                 (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 205 from chain C (tyrosine) into glutamic 
                       acid: Energy difference: -2.3302 kcal/mol, Difference in average score from 
                       the base case: -0.0143                                                      (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 205 from chain C (tyrosine) into lysine:  
                       Energy difference: -0.3351 kcal/mol, Difference in average score from the   
                       base case: -0.0174                                                          (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 205 from chain C (tyrosine) into aspartic 
                       acid: Energy difference: -0.1578 kcal/mol, Difference in average score from 
                       the base case: -0.0159                                                      (00:24:30)
[INFO]       Auto_mut: Effect of mutation residue number 205 from chain C (tyrosine) into          
                       arginine: Energy difference: -0.4115 kcal/mol, Difference in average score  
                       from the base case: -0.0186                                                 (00:24:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:24:37)

Note Your prediction results will be deleted after 360 days.

Drag cursor over the plot to display residue labels.

Show buried residues

Minimal score value: -3.7049
Maximal score value: 2.0856
Average score: -0.5357
Total score value: -261.4203

Download the table (csv)

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
residue index	residue name	chain	Aggrescan3D score	mutation
97	L	C	0.7708
98	A	C	-0.2161
99	D	C	-1.6755
100	K	C	-1.1616
101	I	C	0.2529
102	G	C	-1.0301
103	T	C	-1.5397
104	E	C	-1.8894
105	I	C	-0.3478
106	G	C	-0.1361
107	P	C	-0.1828
108	K	C	-0.5817
109	V	C	1.0334
110	S	C	0.6944
111	L	C	1.5517
112	I	C	1.8602
113	D	C	0.0661
114	T	C	0.9310
115	S	C	1.4452
116	S	C	0.9025
117	T	C	0.7477
118	I	C	2.0856
119	T	C	1.2281
120	I	C	1.7118
121	P	C	1.6046
122	A	C	1.3541
123	N	C	0.7228
124	I	C	1.9074
125	G	C	0.0000
126	L	C	0.7809
127	L	C	1.5950
128	G	C	1.2165
129	S	C	0.0000
130	K	C	0.0684
131	I	C	1.5545
132	S	C	0.6045
133	Q	C	-0.1095
134	S	C	0.1066
135	T	C	0.0420
136	A	C	-0.5317
137	S	C	-0.3779
138	I	C	0.2294
139	N	C	-1.9051
140	E	C	-3.0439
141	N	C	-2.4771
142	V	C	-1.5833
143	N	C	-3.1034
144	E	C	-3.7049
145	K	C	-3.0619
146	C	C	-1.2501
147	K	C	-1.7055
148	F	C	0.9394
149	T	C	1.2799
150	L	C	2.0718
151	P	C	1.0230
152	P	C	0.4712
153	L	C	1.1491
154	K	C	-0.8013
155	I	C	0.5278
156	H	C	-1.2324
157	E	C	-2.1034
158	C	C	-0.5742
159	N	C	-0.8619
160	I	C	0.8675
161	S	C	0.2897
162	C	C	0.8968
163	P	C	0.0504
177	G	C	-1.2050
178	V	C	-1.2758
179	S	C	-1.0230
180	N	C	-0.5290
181	L	C	0.0000
182	V	C	0.7548
183	G	C	0.1247
184	L	C	0.2582
185	P	C	-0.1946
186	N	C	-1.2840
187	N	C	-2.1354
188	I	C	0.0000
189	C	C	0.0000
190	L	C	-1.3344
191	Q	C	-1.8727
192	K	C	-2.4169
193	T	C	-1.6220
194	S	C	-1.5927
195	N	C	-1.9510
196	Q	C	-2.1019
197	I	C	-1.3244
198	L	C	0.0000
199	K	C	-2.4129
200	P	C	-1.1759
201	K	C	-0.6632
202	L	C	0.7625
203	I	C	0.0000
204	S	C	0.8173
205	Y	C	1.6234
206	T	C	0.9315
207	L	C	0.0000
208	P	C	0.6124
209	V	C	0.0000
210	V	C	1.2710
211	G	C	-0.3830
212	Q	C	-1.1097
213	S	C	-1.2768
214	G	C	-0.9000
215	T	C	0.0000
216	C	C	0.0000
217	I	C	0.0000
218	T	C	0.0000
219	D	C	-1.5193
220	P	C	0.0000
221	L	C	0.0000
222	L	C	0.0000
223	A	C	0.0000
224	M	C	-0.4676
225	D	C	-1.2299
226	E	C	-2.2418
227	G	C	-0.9640
228	Y	C	-0.6153
229	F	C	0.0000
230	A	C	0.0000
231	Y	C	0.0000
232	S	C	0.0000
233	H	C	0.0000
234	L	C	0.0000
235	E	C	-0.7142
236	R	C	-0.3773
237	I	C	0.4177
238	G	C	-0.0222
239	S	C	-0.5611
240	C	C	-0.5776
241	S	C	-0.8381
242	R	C	-1.4867
243	G	C	-0.1642
244	V	C	0.7940
245	S	C	-0.6524
246	K	C	-1.3582
247	Q	C	-1.2897
248	R	C	0.0000
249	I	C	0.0000
250	I	C	0.0000
251	G	C	0.0000
252	V	C	0.0000
253	G	C	0.0000
254	E	C	-0.3071
255	V	C	0.0000
256	L	C	-0.8037
257	D	C	-3.0863
258	R	C	-3.0309
259	G	C	-2.7275
260	D	C	-3.4857
261	E	C	-3.6367
262	V	C	0.0000
263	P	C	0.0000
264	S	C	0.0000
265	L	C	0.0000
266	F	C	0.6363
267	M	C	0.6401
268	T	C	0.0000
269	N	C	0.0000
270	V	C	1.2585
271	W	C	0.3296
272	T	C	-0.0475
273	P	C	0.0000
274	P	C	-0.9606
275	N	C	-1.8087
276	P	C	-1.4922
277	N	C	-1.5911
278	T	C	-0.8445
279	V	C	0.0000
280	Y	C	-0.3739
281	H	C	-0.3688
282	C	C	-0.1106
283	S	C	0.0000
284	A	C	0.0000
285	V	C	0.0000
286	Y	C	0.0000
287	N	C	0.0000
288	N	C	-2.2779
289	E	C	-1.8315
290	F	C	-0.8756
291	Y	C	0.0000
292	Y	C	0.0000
293	V	C	0.0000
294	L	C	0.0000
295	C	C	0.0000
296	A	C	0.0000
297	V	C	0.2727
298	S	C	0.0000
299	T	C	-0.0143
300	V	C	0.3946
301	G	C	-0.0900
302	D	C	-0.2560
303	P	C	0.0000
304	I	C	0.0000
305	L	C	1.1955
306	N	C	0.3269
307	S	C	0.1556
308	T	C	0.3666
309	Y	C	1.2644
310	W	C	0.0000
311	S	C	0.1596
312	G	C	-0.3340
313	S	C	-0.4708
314	L	C	0.0000
315	M	C	-0.0746
316	M	C	0.0000
317	T	C	0.0000
318	R	C	-0.8962
319	L	C	0.0000
320	A	C	0.0000
321	V	C	0.0000
322	K	C	-0.8094
323	P	C	0.0000
324	K	C	-1.9857
325	S	C	-1.6027
326	N	C	-1.9729
327	G	C	0.0000
328	G	C	-1.4641
329	G	C	-1.2703
330	Y	C	-1.0018
331	N	C	-1.1473
332	Q	C	-1.1331
333	H	C	-1.4174
334	Q	C	-0.9912
335	L	C	-0.2577
336	A	C	-0.2502
337	L	C	0.0000
338	R	C	-2.1482
339	S	C	-1.7014
340	I	C	-1.5693
341	E	C	-2.1482
342	K	C	-2.0238
343	G	C	-1.8862
344	R	C	-2.2320
345	Y	C	0.0000
346	D	C	-1.4520
347	K	C	-1.0574
348	V	C	0.0000
349	M	C	0.0000
350	P	C	0.0000
351	Y	C	0.0000
352	G	C	0.0000
353	P	C	0.0000
354	S	C	0.0000
355	G	C	-0.2598
356	I	C	0.0000
357	K	C	-1.6619
358	Q	C	-1.8022
359	G	C	-1.9105
360	D	C	-2.4421
361	T	C	-1.6298
362	L	C	0.0000
363	Y	C	0.0000
364	F	C	0.0000
365	P	C	0.0000
366	A	C	0.0000
367	V	C	0.0000
368	G	C	0.0000
369	F	C	0.0000
370	L	C	0.0000
371	V	C	-1.0393
372	R	C	-1.4633
373	T	C	-1.3728
374	E	C	-2.3894
375	F	C	0.0000
376	K	C	-2.4480
377	Y	C	-1.9970
378	N	C	-2.4096
379	D	C	-2.3577
380	S	C	-1.5754
381	N	C	-2.0167
382	C	C	0.0000
383	P	C	-0.9865
384	I	C	-1.0570
385	T	C	-1.2668
386	K	C	-1.7109
387	C	C	-1.0249
388	Q	C	-1.0599
389	Y	C	0.1677
390	S	C	-0.8655
391	K	C	-1.8901
392	P	C	-1.8106
393	E	C	-1.9633
394	N	C	-1.1651
395	C	C	0.0000
396	R	C	-1.0401
397	L	C	-0.6661
398	S	C	0.0000
399	M	C	0.0000
400	G	C	0.0000
401	I	C	-0.4626
402	R	C	-2.0151
403	P	C	-1.4914
404	N	C	-2.0709
405	S	C	-1.5059
406	H	C	-1.5608
407	Y	C	0.0000
408	I	C	0.0000
409	L	C	0.0000
410	R	C	-0.5713
411	S	C	0.0000
412	G	C	0.0000
413	L	C	0.0000
414	L	C	0.0000
415	K	C	-0.9811
416	Y	C	0.0000
417	N	C	-1.3747
418	L	C	-0.7007
419	S	C	-0.6901
424	P	C	-0.8815
425	K	C	-1.7892
426	V	C	0.0000
427	V	C	-0.8222
428	F	C	0.0000
429	I	C	0.0000
430	E	C	-1.6180
431	I	C	0.0000
432	S	C	-1.6847
433	D	C	-2.5581
434	Q	C	-2.4092
435	R	C	-1.8672
436	L	C	-1.4437
437	S	C	-0.6136
438	I	C	0.0000
439	G	C	0.0000
440	S	C	0.0000
441	P	C	-0.0105
442	S	C	0.0000
443	K	C	0.0000
444	I	C	0.0000
445	Y	C	0.0000
446	D	C	-0.7625
447	S	C	0.0000
448	L	C	0.2276
449	G	C	-0.4618
450	Q	C	-0.4879
451	P	C	-0.4340
452	V	C	0.0000
453	F	C	0.0000
454	Y	C	0.0000
455	Q	C	0.0000
456	A	C	0.0000
457	S	C	0.0000
458	F	C	0.2233
459	S	C	0.0000
460	W	C	-0.0978
461	D	C	-0.0640
462	T	C	0.0000
463	M	C	0.1828
464	I	C	0.0000
465	K	C	0.0000
466	F	C	0.0000
467	G	C	0.0000
468	D	C	-0.3622
469	V	C	0.0000
470	L	C	0.9867
471	T	C	0.2890
472	V	C	-0.2591
473	N	C	-1.3249
474	P	C	-0.9507
475	L	C	0.0000
476	V	C	-0.3402
477	V	C	0.0000
478	N	C	-1.3117
479	W	C	-1.1404
480	R	C	-1.6028
481	N	C	-1.8329
482	N	C	0.0000
483	T	C	-0.6832
484	V	C	-0.2332
485	I	C	0.0000
486	S	C	0.0000
487	R	C	0.0000
488	P	C	0.0000
489	G	C	0.0000
490	Q	C	-2.3441
492	Q	C	-1.7468
493	C	C	0.0000
494	P	C	-1.4862
495	R	C	-0.9291
496	F	C	0.7547
497	N	C	-0.0468
498	T	C	-0.0930
499	C	C	-0.3850
500	P	C	0.0000
501	E	C	-0.6963
502	I	C	-0.4607
503	C	C	-0.3961
504	W	C	-0.0937
505	E	C	-0.3005
506	G	C	-0.3588
507	V	C	-0.1115
508	Y	C	0.0000
509	N	C	0.0000
510	D	C	0.0000
511	A	C	0.0000
512	F	C	0.0000
513	L	C	0.0000
514	I	C	0.0000
515	D	C	0.0000
516	R	C	0.1342
517	I	C	1.2510
518	N	C	-0.4468
519	W	C	-0.3283
520	I	C	0.0000
521	S	C	0.0000
522	A	C	0.0000
523	G	C	0.0000
524	V	C	0.0000
525	F	C	0.0000
526	L	C	0.0000
527	D	C	-1.4864
528	S	C	-1.6787
529	N	C	-2.1492
530	Q	C	-2.5358
531	T	C	-1.6707
532	A	C	-1.2400
533	E	C	-2.1216
534	N	C	-2.1112
535	P	C	0.0000
536	V	C	0.0000
537	F	C	0.0000
538	T	C	0.0000
539	V	C	0.0000
540	F	C	0.0000
541	K	C	-1.7212
542	D	C	-1.7721
543	N	C	-1.9524
544	E	C	-1.3924
545	I	C	-0.8793
546	L	C	0.0000
547	Y	C	0.0000
548	R	C	-1.9513
549	A	C	0.0000
550	Q	C	-1.9356
551	L	C	-1.0654
552	A	C	-1.1653
553	S	C	-1.9847
554	E	C	-3.2490
555	D	C	-3.0546
556	T	C	-2.4153
557	N	C	-2.2198
558	A	C	0.0000
559	Q	C	-0.7777
560	K	C	-0.7136
561	T	C	0.0000
562	I	C	0.0000
563	T	C	0.0000
564	N	C	0.0000
565	C	C	0.0000
566	F	C	0.0000
567	L	C	0.0000
568	L	C	0.0000
569	K	C	-2.7119
570	N	C	-2.5106
571	K	C	-2.5161
572	I	C	0.0000
573	W	C	0.0000
574	C	C	0.0000
575	I	C	0.0000
576	S	C	0.0000
577	L	C	0.0000
578	V	C	0.0000
579	E	C	0.0000
580	I	C	0.0000
581	Y	C	-1.7012
582	D	C	-2.8387
583	T	C	-2.2254
584	G	C	-2.2920
585	D	C	-3.0889
586	N	C	-2.8967
587	V	C	-1.7082
588	I	C	0.0000
589	R	C	-0.4518
590	P	C	0.0000
591	K	C	-0.1817
592	L	C	0.0000
593	F	C	0.0000
594	A	C	0.0000
595	V	C	0.0000
596	K	C	-1.5891
597	I	C	0.0000
598	P	C	-1.4373
599	E	C	-2.1797
600	Q	C	-1.3802
601	C	C	-0.7602
602	Y	C	0.4221

3Dmol can be expensive computationally for big molecules. If you experience lag or delay click on the "Play the video" button instead.

Download PDB file

View in 3Dmol

Start animation

Play the video

Automated mutations analysis

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file.

Mutant	Energetic effect	Score comparison
IR118C	-0.8526	-0.0324	View	CSV	PDB
IR120C	-0.6893	-0.0366	View	CSV	PDB
YE205C	-2.3302	-0.0143	View	CSV	PDB
IR112C	-0.1846	-0.037	View	CSV	PDB
IK112C	-0.2796	-0.0299	View	CSV	PDB
IK120C	-0.0253	-0.039	View	CSV	PDB
YR205C	-0.4115	-0.0186	View	CSV	PDB
LR150C	0.0425	-0.0217	View	CSV	PDB
IR124C	0.215	-0.0329	View	CSV	PDB
IK124C	0.1955	-0.0299	View	CSV	PDB
LK150C	0.2028	-0.0202	View	CSV	PDB
IK118C	0.3132	-0.0275	View	CSV	PDB

Project name: down_conf

Status: done

Started: 2026-01-20 16:02:04

Automated mutations analysis

Mutant

Energetic effect

Score comparison