Project name: ef34c4664506c68

Status: done

Started: 2026-03-18 16:16:17
Settings
Chain sequence(s) A: SLKDEIEDILQTFTIIYNFFKEDIESGKMKEEDVLMLIRSNLEYGYGETKAYPIVKPIFDKIVEEGKKEGKNGLEIIEEFIEELKKLAAEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:20)
Show buried residues

Minimal score value
-4.9876
Maximal score value
1.9534
Average score
-1.5817
Total score value
-143.9351

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -1.3996
2 L A -1.5845
3 K A -2.7044
4 D A -3.2103
5 E A -2.8984
6 I A 0.0000
7 E A -3.4246
8 D A -3.4038
9 I A 0.0000
10 L A -1.8695
11 Q A -1.6574
12 T A -0.5348
13 F A 0.0000
14 T A 0.2124
15 I A 1.9534
16 I A 1.4476
17 Y A 0.3052
18 N A 0.0304
19 F A 1.5539
20 F A -0.2137
21 K A -1.5997
22 E A -2.9915
23 D A -2.7865
24 I A 0.0000
25 E A -3.4725
26 S A -2.7161
27 G A -2.8384
28 K A -3.0638
29 M A -2.9908
30 K A -3.6653
31 E A -3.1724
32 E A -2.9954
33 D A -2.4669
34 V A 0.0000
35 L A 0.0000
36 M A -0.6210
37 L A -0.4490
38 I A 0.0000
39 R A -1.8442
40 S A -0.8735
41 N A -0.9970
42 L A 0.0000
43 E A -1.5370
44 Y A -0.2361
45 G A -0.8500
46 Y A -1.3915
47 G A -1.5888
48 E A -2.3319
49 T A -1.9063
50 K A -2.1325
51 A A 0.0000
52 Y A -1.0103
53 P A -0.5441
54 I A 0.3406
55 V A 0.0000
56 K A -0.9405
57 P A -0.7286
58 I A -0.7862
59 F A 0.0000
60 D A -2.4588
61 K A -3.1871
62 I A 0.0000
63 V A 0.0000
64 E A -4.5140
65 E A -4.5955
66 G A -4.5316
67 K A -4.9876
68 K A -4.6695
69 E A -4.3962
70 G A -3.3851
71 K A -3.4340
72 N A -2.3443
73 G A 0.0000
74 L A 0.0000
75 E A -2.1368
76 I A 0.0000
77 I A 0.0000
78 E A -2.4257
79 E A -3.1908
80 F A 0.0000
81 I A 0.0000
82 E A -3.3770
83 E A -2.7110
84 L A 0.0000
85 K A -3.4357
86 K A -3.2285
87 L A -2.1356
88 A A 0.0000
89 A A -2.0255
90 E A -2.4586
91 A A -1.7209
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018