Project name: ef657fb3437b0e2

Status: done

Started: 2026-07-19 00:34:57
Settings
Chain sequence(s) A: YPQSIDWRAKGAVTPVKNQGACGSCWAFSTIATVEGINKIVTGNLLELSEQELVDCDKHSYGCKGGYQTTSLQYVANNGVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNSQGTCGVYKSSYYPFKGFA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:18)
Show buried residues

Minimal score value
-2.5836
Maximal score value
1.692
Average score
-0.6147
Total score value
-133.9947

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 0.7082
2 P A -0.1847
3 Q A -1.1253
4 S A -0.7219
5 I A 0.0000
6 D A -1.0626
7 W A 0.0000
8 R A -1.4784
9 A A -1.3205
10 K A -2.0206
11 G A -1.3323
12 A A 0.0000
13 V A -0.5169
14 T A 0.0000
15 P A -0.6216
16 V A -0.7989
17 K A -0.9608
18 N A -1.5704
19 Q A 0.0000
20 G A -1.1070
21 A A -0.5672
22 C A 0.0000
23 G A -0.8391
24 S A 0.0000
25 C A -0.4278
26 W A 0.0000
27 A A 0.0000
28 F A 0.0000
29 S A 0.0000
30 T A 0.0000
31 I A 0.0000
32 A A -0.1194
33 T A 0.0000
34 V A 0.0000
35 E A 0.0000
36 G A 0.0000
37 I A 0.0000
38 N A 0.0000
39 K A -0.3113
40 I A 0.3560
41 V A 1.1652
42 T A 0.1590
43 G A -0.6206
44 N A -1.1413
45 L A -0.1718
46 L A -0.5032
47 E A -1.0547
48 L A 0.0000
49 S A 0.0000
50 E A 0.0000
51 Q A 0.0000
52 E A 0.0000
53 L A 0.0000
54 V A 0.0000
55 D A 0.0000
56 C A 0.0000
57 D A 0.0000
58 K A -1.9482
59 H A -1.4811
60 S A 0.0000
61 Y A -0.1740
62 G A 0.0000
63 C A -1.1268
64 K A -1.6309
65 G A -0.7175
66 G A -0.2375
67 Y A 0.5502
68 Q A 0.0000
69 T A -0.3327
70 T A -0.4843
71 S A 0.0000
72 L A 0.0000
73 Q A -0.8595
74 Y A -1.1888
75 V A 0.0000
76 A A 0.0000
77 N A -1.8294
78 N A -1.7595
79 G A 0.0000
80 V A 0.0000
81 H A 0.0000
82 T A -1.2719
83 S A -0.9802
84 K A -1.7654
85 V A -0.8351
86 Y A 0.0000
87 P A -0.6953
88 Y A -0.9055
89 Q A -1.2976
90 A A -1.4440
91 K A -2.2577
92 Q A -1.6242
93 Y A -1.1209
94 K A -1.5771
95 C A -1.1963
96 R A -1.3644
97 A A -1.3390
98 T A -1.2382
99 D A -2.2164
100 K A -1.8592
101 P A -1.3711
102 G A -1.3551
103 P A -1.4668
104 K A -2.2961
105 V A 0.0000
106 K A -1.1565
107 I A 0.0000
108 T A -0.0096
109 G A -0.3775
110 Y A -0.4696
111 K A -1.6908
112 R A -2.0010
113 V A 0.0000
114 P A -0.9608
115 S A -1.0967
116 N A -1.4734
117 C A -1.1446
118 E A -0.9888
119 T A -0.3704
120 S A -0.4409
121 F A 0.0000
122 L A 0.0000
123 G A -0.1274
124 A A -0.4664
125 L A 0.0000
126 A A -0.5271
127 N A -0.9872
128 Q A 0.0000
129 P A 0.0000
130 L A 0.0000
131 S A 0.0000
132 V A 0.0000
133 L A -0.2317
134 V A 0.0000
135 E A 0.0000
136 A A 0.0000
137 G A -1.6550
138 G A -1.3891
139 K A -1.7525
140 P A -1.1638
141 F A 0.0000
142 Q A -0.8662
143 L A 0.1554
144 Y A 0.0000
145 K A -2.0479
146 S A -1.3158
147 G A -1.0457
148 V A -1.1442
149 F A 0.0000
150 D A -2.0311
151 G A -1.3509
152 P A -1.0072
153 C A -1.0272
154 G A -0.8452
155 T A -1.2363
156 K A -2.0535
157 L A -1.3628
158 D A -2.0600
159 H A 0.0000
160 A A 0.0000
161 V A 0.0000
162 T A 0.0000
163 A A 0.0000
164 V A 0.0000
165 G A 0.0000
166 Y A 0.0000
167 G A 0.0000
168 T A -1.3109
169 S A -1.4983
170 D A -2.3604
171 G A -1.8396
172 K A -1.8770
173 N A -1.6041
174 Y A -0.8939
175 I A 0.0000
176 I A 0.0000
177 I A 0.0000
178 K A 0.0000
179 N A 0.0000
180 S A 0.0000
181 W A -0.9416
182 G A 0.0000
183 P A -1.7758
184 N A -2.2519
185 W A 0.0000
186 G A -1.8067
187 E A -2.1081
188 K A -2.5836
189 G A 0.0000
190 Y A 0.0000
191 M A 0.0000
192 R A -0.7540
193 L A 0.0000
194 K A -1.3802
195 R A 0.0000
196 Q A -1.5136
197 S A -1.1497
198 G A -1.2559
199 N A -1.8264
200 S A -1.5121
201 Q A -1.6172
202 G A 0.0000
203 T A 0.0000
204 C A 0.0000
205 G A 0.0000
206 V A 0.0000
207 Y A 0.0000
208 K A -0.7478
209 S A -0.5311
210 S A 0.0000
211 Y A -0.6658
212 Y A -0.3686
213 P A 0.0000
214 F A 0.8586
215 K A 0.7530
216 G A 0.6151
217 F A 1.6920
218 A A 0.8677
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018