Project name: ef713e2eef0b4f2

Chain sequence(s)	A: NFLLTQPPSVSESPGKTVTLSCTVSSDSFGGNYVQWYQQRPGSVTRILIYENSQRPSGVPPRFSGSIDGSGKSASLTISGVEPEDEADYYCQSFDGTNVVFGGGTKLTV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:54)

• Minimal score value: -2.8971
• Maximal score value: 1.5823
• Average score: -0.7155
• Total score value: -77.9872

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.3981
2	F	A	-0.1973
3	L	A	1.1204
4	L	A	0.0000
5	T	A	0.2059
6	Q	A	-0.3463
7	P	A	-0.6357
8	P	A	-0.9407
9	S	A	-1.0002
10	V	A	-0.5339
11	S	A	-0.7776
12	E	A	-1.2477
13	S	A	-1.2412
14	P	A	-1.5255
15	G	A	-1.8028
16	K	A	-2.1635
17	T	A	-1.3423
18	V	A	0.0000
19	T	A	-0.2227
20	L	A	0.0000
21	S	A	-0.1457
22	C	A	0.0000
23	T	A	-0.5267
24	V	A	0.0000
25	S	A	-0.4408
26	S	A	-1.1947
27	D	A	-2.2725
28	S	A	-2.1107
29	F	A	0.0000
30	G	A	-1.4070
31	G	A	-1.2223
32	N	A	-0.7374
33	Y	A	0.2257
34	V	A	0.0000
35	Q	A	-0.0005
36	W	A	0.0000
37	Y	A	-0.0470
38	Q	A	0.0000
39	Q	A	-1.5557
40	R	A	-2.5485
41	P	A	-1.2485
42	G	A	-0.6759
43	S	A	-0.3546
44	V	A	0.7644
45	T	A	-0.3904
46	R	A	-1.2707
47	I	A	-0.1595
48	L	A	0.0000
49	I	A	0.0000
50	Y	A	-0.4969
51	E	A	-1.2351
52	N	A	-0.9369
53	S	A	-1.1477
54	Q	A	-1.8116
55	R	A	-1.4409
56	P	A	-0.7743
57	S	A	-0.7173
58	G	A	-0.6379
59	V	A	-0.5044
60	P	A	-0.4870
61	P	A	-0.6293
62	R	A	-0.5340
63	F	A	0.0000
64	S	A	-0.7087
65	G	A	-0.6970
66	S	A	-0.7813
67	I	A	-0.8187
68	D	A	-2.2066
69	G	A	-1.9977
70	S	A	-1.4564
71	G	A	-1.6648
72	K	A	-2.3750
73	S	A	-1.4530
74	A	A	0.0000
75	S	A	-0.4350
76	L	A	0.0000
77	T	A	-0.2738
78	I	A	0.0000
79	S	A	-1.0649
80	G	A	-1.4373
81	V	A	0.0000
82	E	A	-2.6850
83	P	A	-2.1005
84	E	A	-2.8971
85	D	A	0.0000
86	E	A	-2.8908
87	A	A	0.0000
88	D	A	-1.8855
89	Y	A	0.0000
90	Y	A	-0.1355
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	F	A	0.1165
95	D	A	-1.1856
96	G	A	-1.1525
97	T	A	-0.7016
98	N	A	-0.9724
99	V	A	0.8376
100	V	A	0.9861
101	F	A	1.5823
102	G	A	0.5899
103	G	A	-0.3168
104	G	A	-0.6743
105	T	A	0.0000
106	K	A	-2.4307
107	L	A	0.0000
108	T	A	-1.1993
109	V	A	-0.7803