Project name: efca5e447cd200e

Status: done

Started: 2026-06-22 16:05:29
Settings
Chain sequence(s) B: SALRALMAELMARLERRIEVLREMAKQAGVPEEEVEEKAAELRARLEAAL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-4.9411
Maximal score value
1.2694
Average score
-1.7809
Total score value
-89.0437

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.0334
2 A B 0.6155
3 L B 1.2694
4 R B -0.5484
5 A B 0.1374
6 L B 1.2566
7 M B 0.2756
8 A B -0.3473
9 E B -1.0697
10 L B -0.5353
11 M B -1.3315
12 A B -1.8189
13 R B -3.0396
14 L B -2.5188
15 E B -3.4808
16 R B -3.9150
17 R B -3.6045
18 I B 0.0000
19 E B -3.2640
20 V B -0.9976
21 L B -1.4847
22 R B -3.1322
23 E B -2.5861
24 M B -0.7552
25 A B 0.0000
26 K B -2.7508
27 Q B -2.1530
28 A B -1.1124
29 G B -1.2364
30 V B -1.2935
31 P B -2.2383
32 E B -4.0177
33 E B -4.5471
34 E B -4.4896
35 V B 0.0000
36 E B -4.8855
37 E B -4.9411
38 K B -4.1399
39 A B 0.0000
40 A B -2.8425
41 E B -3.3602
42 L B -2.4905
43 R B -2.8941
44 A B -2.2855
45 R B -2.6129
46 L B -1.4311
47 E B -2.0718
48 A B -0.9356
49 A B -0.2190
50 L B 0.8133
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018