Project name: efd49b28ff5234

Chain sequence(s)	A: DFMLSQPHSVSESPGKTVTISCTRSSGLIGSNYVQWFQQRPGSAPTTVIYEDVQRPSGVPDRFSGSIDSSSNSASLTISGLQSEDEADYYCQSYDTKTWVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:51)

• Minimal score value: -2.5658
• Maximal score value: 1.8161
• Average score: -0.4586
• Total score value: -50.4465

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-1.7206
2	F	A	0.0000
3	M	A	0.5441
4	L	A	0.0000
5	S	A	-0.1945
6	Q	A	-0.5374
7	P	A	-0.8742
8	H	A	-1.4338
9	S	A	-0.9199
10	V	A	-0.4370
11	S	A	-0.1574
12	E	A	-0.5739
13	S	A	-0.4419
14	P	A	-0.8913
15	G	A	-1.5909
16	K	A	-1.9844
17	T	A	-1.1935
18	V	A	0.0000
19	T	A	-0.1759
20	I	A	0.0000
21	S	A	-0.1554
22	C	A	0.0000
23	T	A	-0.2567
24	R	A	-0.1378
25	S	A	-0.2876
26	S	A	-0.4016
27	G	A	-0.3485
28	L	A	0.3670
29	I	A	0.0000
30	G	A	-0.2659
31	S	A	-0.1051
32	N	A	-0.1711
33	Y	A	0.5687
34	V	A	0.0000
35	Q	A	0.2220
36	W	A	0.0000
37	F	A	0.0671
38	Q	A	0.0000
39	Q	A	-1.5048
40	R	A	-2.3462
41	P	A	-1.4241
42	G	A	-1.0153
43	S	A	-0.9248
44	A	A	-0.5460
45	P	A	-0.6926
46	T	A	-0.3209
47	T	A	-0.0576
48	V	A	0.0000
49	I	A	0.0000
50	Y	A	-0.1291
51	E	A	-0.5390
52	D	A	0.0969
53	V	A	0.9183
54	Q	A	-0.7405
55	R	A	-1.2066
56	P	A	-0.8858
57	S	A	-0.8551
58	G	A	-0.8292
59	V	A	-0.7661
60	P	A	-1.2482
61	D	A	-2.2033
62	R	A	-1.3365
63	F	A	0.0000
64	S	A	-0.4286
65	G	A	0.0000
66	S	A	-0.0262
67	I	A	-0.0064
68	D	A	-1.1625
69	S	A	-0.7590
70	S	A	-0.6172
71	S	A	-0.6166
72	N	A	-0.6338
73	S	A	-0.5814
74	A	A	0.0000
75	S	A	-0.1136
76	L	A	0.0000
77	T	A	-0.2410
78	I	A	0.0000
79	S	A	-1.2126
80	G	A	-1.4250
81	L	A	0.0000
82	Q	A	-1.8421
83	S	A	-1.5105
84	E	A	-2.5658
85	D	A	0.0000
86	E	A	-2.0247
87	A	A	0.0000
88	D	A	-1.6711
89	Y	A	0.0000
90	Y	A	0.1626
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	Y	A	0.5303
95	D	A	-0.4840
96	T	A	-1.0563
97	K	A	-1.4606
98	T	A	-0.3854
99	W	A	1.1888
100	V	A	0.0000
101	F	A	1.8161
102	G	A	0.5583
103	G	A	-0.4022
104	G	A	-0.6120
105	T	A	0.0000
106	K	A	-1.4506
107	L	A	0.0000
108	T	A	-0.3153
109	V	A	-0.2181
110	L	A	1.1639