Project name: efe670b713087dc

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGRTLRFSAYGMGWFRQAPGKGLELVSAISQWGVGNTYYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYVCAADTSPVTWYPADGYHYDAWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -2.5614
• Maximal score value: 1.7355
• Average score: -0.3935
• Total score value: -50.758

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.6132
2	V	A	-0.2235
3	Q	A	-0.8809
4	L	A	0.0000
5	V	A	0.7588
6	E	A	0.3012
7	S	A	-0.2629
8	G	A	-0.7068
9	G	A	0.2145
10	G	A	0.9297
11	L	A	1.5160
12	V	A	0.0088
13	Q	A	-1.2858
14	P	A	-1.2967
15	G	A	-1.3266
16	G	A	-1.0782
17	S	A	-1.0858
18	L	A	-0.7454
19	R	A	-1.6284
20	L	A	0.0000
21	S	A	-0.3054
22	C	A	0.0000
23	A	A	-0.0966
24	A	A	-0.4030
25	S	A	-0.9135
26	G	A	-1.3454
27	R	A	-1.6182
28	T	A	-1.0536
29	L	A	0.0000
30	R	A	-0.6045
31	F	A	1.1988
32	S	A	0.7476
33	A	A	0.5427
34	Y	A	0.0000
35	G	A	0.0000
35A	M	A	0.0000
35B	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-0.8584
40	A	A	-1.1638
41	P	A	-1.1424
42	G	A	-1.6407
43	K	A	-2.2816
44	G	A	-1.2795
45	L	A	-0.2776
46	E	A	-0.8353
47	L	A	0.0000
48	V	A	0.0000
49	S	A	0.0000
50	A	A	0.0000
51	I	A	0.0000
52	S	A	0.0000
52A	Q	A	0.0000
52B	W	A	1.0871
53	G	A	0.5564
54	V	A	1.3496
55	G	A	0.1131
56	N	A	-0.0665
57	T	A	0.1966
58	Y	A	0.1089
59	Y	A	-0.7401
60	A	A	-1.3181
61	D	A	-2.4649
62	S	A	-1.7674
63	V	A	0.0000
64	K	A	-2.5614
65	G	A	-1.7510
66	R	A	-1.5215
67	F	A	0.0000
68	T	A	-0.7243
69	I	A	0.0000
70	S	A	0.0692
71	R	A	0.0000
72	D	A	-0.6547
73	N	A	-0.7050
74	A	A	-1.0738
75	K	A	-1.9896
76	N	A	-1.5385
77	T	A	-0.5163
78	L	A	0.0000
79	Y	A	-0.2895
80	L	A	0.0000
81	Q	A	-1.0224
82	M	A	0.0000
82A	N	A	-1.2085
82B	S	A	-1.1188
82C	L	A	0.0000
83	R	A	-2.1511
84	A	A	-1.4838
85	E	A	-2.1741
86	D	A	0.0000
87	T	A	-0.3496
88	A	A	0.0000
89	V	A	1.0735
90	Y	A	0.0000
91	V	A	0.4524
92	C	A	0.0000
93	A	A	0.0000
94	A	A	0.0000
95	D	A	-0.9621
96	T	A	-0.4020
97	S	A	-0.0565
98	P	A	0.1801
99	V	A	1.1494
100	T	A	0.4084
100A	W	A	0.5216
100B	Y	A	0.3361
100C	P	A	-0.2376
100D	A	A	-0.6272
100E	D	A	-1.5298
100F	G	A	-0.7628
100G	Y	A	-0.0225
100H	H	A	-1.2439
100I	Y	A	0.0000
101	D	A	-1.8374
102	A	A	-0.7982
103	W	A	-0.1334
104	G	A	-0.0734
105	Q	A	-0.7583
106	G	A	0.0709
107	T	A	0.6693
108	L	A	1.7355
109	V	A	0.0000
110	T	A	0.4739
111	V	A	0.0000
112	S	A	-0.4731
113	S	A	-0.4653